Entry information : EglRboh02
Entry ID 11033
Creation 2012-05-18 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: EglRboh02
Name EglRboh02
Class Respiratory burst oxidase homolog     [Orthogroup: Rboh002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglRboh02
start..stop
S start..stop
EgrRboh02 1596 0 23..815 153..965
EgrRboh02 94 5.94e-20 1..62 1..62
EguRboh02 1583 0 23..815 153..965
EguRboh02 94 5.79e-20 1..62 1..62
EcamRboh02 1583 0 23..815 152..964
EcamRboh02 92 4.54e-19 1..62 1..62
ToriRboh06 1399 0 45..815 161..963
ToriRboh06 49 0.00000589 1..44 1..50
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11033' 'join(1..132,487..709,823..982,1369..1417,2169..2282,3849..4271,5812..6198,6584..6699,6841..7008,7125..7284,7428..7625,7726..7854,7969..8047,8142..8251)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..132 130 N° 2 487..709 221 N° 3 823..982 158 N° 4 1369..1417 47
N° 5 2169..2282 112 N° 6 3849..4271 421 N° 7 5812..6198 385 N° 8 6584..6699 114
N° 9 6841..7008 166 N° 10 7125..7284 158 N° 11 7428..7625 196 N° 12 7726..7854 127
N° 13 7969..8047 77 N° 14 8142..8251 108  
join(1..132,487..709,823..982,1369..1417,2169..2282,3849..4271,5812..6198,6584.. 6699,6841..7008,7125..7284,7428..7625,7726..7854,7969..8047,8142..8251)


exon

Literature and cross-references EglRboh02
Protein sequence: EglRboh02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   815 (297)
PWM (Da):   %s   92675.95 (32451.7) Transmb domain:   %s   o285-304i424-446o466-488i613-630o
PI (pH):   %s   9.32 (10.40) Peptide Signal:   %s   cut: 20 range:20-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGLAKHGRRWASDTVPGKSPASDSTSPAGTEASYGEELVEVTLAGGFDVALAARALRKQRAQLDRNRSGAQKALRGLRFISNSKTNCSIDAWNEIQASFDKLAKDGCLYRQDFAQCIGMKDSKEFALELFDALGRRRRMKVDRISKDELHEFWCQITDQSFDS
RLQIFFD
MVDKNEDGRITGEEVKIIMLSASANRLSRLKEQAEEYAALIMEELDPEQLGYIELWQLETLLLQKDTYLNYSQALSYTSQALSQNLQGLRRRSRIRRLSTKCLYYLEENWRRI
WVVTLWVMIMIGLFTWKFVQYKQKAAFQVMGYCLLTAKGAAETLKFNMALILLPVCRNTITWLRNTRVGLFIPFDDNINFHK
TIAAAIVVGVILHVGDHLACDFVRLEHASKDVYHRYLE
DDFGNPKPTYFDLVKGIEGVTGILMVILMLIAFTLATRWFRRSLVKLPKPFDRLTGFNAFWYSHHLFVLVYILLIIHGVFLYLVHHWYRKT
VAIYPGNVLTLKMSKPPQFKYKSGQYMFV
QCPAVSPFE
WHPFSITSAPGDDFLSVHIRQLGDWTQELKRVFAEACEPPVAGKSGLLRADETTKKSLPKLCIDGPYGAPAQDYKKYDVLLLVGLGIGATPFISILKDLINTIVKSEEQDS
VTDVSRNSDLSIGSVESPGPNRVSPRRRKTLKTTNAYFYWVTREQGSFDWFKGVMNEVAEIDQR
GVIEMHNYLTSVYEEGDARSALITMVQALNHAKNGIDIVSGTTVRTHFARPNRKKA
FNKLCSKHSGARI
GVFYCGAPVLAKELSKLCYEFNQKGPTKFDFHKEHF

Retrieve as FASTA  
Remarks Partial sequence from NGS. Parts of the sequence are missing due to NNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGGCCTCGCCAAGCACGGGCGCCGGTGGGCGTCGGACACCGTCCCCGGCAAGTCACCGGCCAGCGACAGCACTTCGCCGGCGGGTACGGAGGCCAGCTACGGCGAGGAGCTCGTG
GAGGTGACCCTC
TCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNTGCCGGCGGCTTCGACGTGGCCCTGGCGGCCCGGGCCCTGCGGAAGCAGCGCGCGCAGCTCGACCGGAACCGCTCGGGCGCCCAAAAGGCCTTGCGCGGGCTGCGGTTCATCA
GCAACAGCAAGACCAACTGCAGCATCGATGCATGGAACGAAATTCAGGCTAGCTTCGATAAGCTTGCCAAAGATGGTTGTCTCTATCGTCAAGATTTCGCACAATGCATAG
AGGTTTTCG
CCATCTCTCTCTCTCTCTCTCTCTCTCTAAATTCACGTCCCTTTATGGTGGATTTCTCTCCTTAGCGTTCATACTGACGACGTCCTTGTCTTTTTTCCCGGTGAAGGAATGAAAGATTCG
AAGGAGTTTGCTTTGGAACTGTTCGATGCATTGGGGAGGAGGAGGAGAATGAAGGTCGACAGGATCAGCAAAGACGAGCTCCACGAGTTCTGGTGTCAGATCACTGATCAGAGCTTCGAT
TCACGTCTCCAGATCTTCTTCGACAT
ATGTACGCATGATGATCGCGATGATGATGATGAATTAAAAAAAAAGAAAANNNNNNNNNNNNNNAACTTTTTTCTTTTCTTCTTTTTTTTTTTA
CACTGTTGTGTTTTGATAAAGATTGCACTTCTTTAACAAACTAAGGAACAGACCGATTCATCTCCATTAGGTATTTTTAATTATTTTCATATTAACGCGAGATGATTGTGTATTGTCAGT
GGGTAAAGAGCCAGAAGCGAGAAAAGCAAGAACAGGGACCGCTGAACAATATCTTAATTATGGACCTAATTATTGATCGAGTCATATGTTTTTTATTTGCACCTAGTACGTTTTTCATTA
AAAACAATCTGTTTGGTCGATAATTAATCTTTTCTCTTGTTGAATACATGACAGGGTAGACAAGAACGAGGACGGAAGAATCACCGGAGAAGAAGTAAAAGAGAGGTGAGAGTTCTGTTT
GAACCGATTGTCATTAGCTGTCATTTTCGAGAAAATTAAAGCTCGATAAGACCCGGCGACCCTGTTAAACTAAACTCCTAGACTGATTATATATATGCGCAATAGATTGGACCGTACATA
ATTAATTGGAATAGGAACTAATGTGCATGAATTAGCCAACACTCCTTCATGTCCTCGTGTAAGCCATCGCAATAAACTAGGTTTTCCTTACAGGGTGTCATGTTTCGGTTACAATATAAT
AATCGATGTTAGGCGAGGTTCGGTGAGCCCCAAAAATCCCTGAAATTCCACAACGAAACTACTCCATCACAACGATAACAAAAAAAAGAAAGCGAAGTTTTATAAAATAATGTTTCGGTT
TTTTCTTTTTTCCTTCCTGGGCTTGCTCTGACGTTGCCCATGTTCTAAAAGCATCTTCTTATTCATTAAAGATTTTTTGGGGGTATTCGTGGGTTTCCATGAGCTCTTAGGCCCCCTATT
CCGTGATGTCTAGGGGGACAAATGGCAAGTTTTCTCCACTACAATCGTATTCCCGAACGCAATAATTACTATTTTCAGTGGGGTTGGTGGGGGCTTTTCGGTCAACTCGGGGCCGGTCCG
ACGTGTCACGGTTGTCTTCTTGATGCATGCAACCTTGGGTTACGTGGACTTGCGAGTCATTAATGCCCGGTTGACGTAAAGAACCCTAATTTCCACAGTTCCTGTTCTTGATTTTGATTG
CTGCCGATGGTTGCAGATCATAATGCTGAGCGCCTCGGCGAATCGATTATCGAGGTTGAAGGAGCAGGCGGAGGAGTACGCAGCTCTGATCATGGAAGAACTGGATCCGGAGCAGCTCGG
CTACATCGAG
AGGTCGGTCCATTTTTTTATTTTATTTTTATGATTTCGCCCTAAAATCTAAAGATAATGCAAAGTCCAAAATACATATATTTCGTCAGACTATAGTTTTCCCAATAGTTA
GTGGGGATACGCATCTTAATCGAGTCAGCTTTGACCAGTAGTTTTTTTATAAGAGTAATACTCGAGGGGGTCTAAGTATTAGTTACGACTTTTCCTCCTAAAGTCCATGTTTGGCGAAAA
ATGGAAATTTTTTTCTAAGAATTGGGTAACCGTGTTGTTGAACCGCGCAAGAAGAAAATAGTAAAAGCTTATGACTATATATAAATATATGTGTGTATATATTCATATTAATATTTGTAG
ACGTAGCTAGCGCATTACTTTTGGATTGACCAAATTAGATTGTTTAGAAGGCAAAAGCAGCTGACGAAATTTCTAAAATTTTTGGTAGTTGAGCGACTTTTCTTCGACCTTCAAGCCCAT
TTCTTCTAAAAGTTTCGGTAATTAGGGTTTCTCCTTTCCGTGGTAACTTTGTTATTTCTAGGTCAGTGCAATAATTGGTACGACCGATAAGCCACGCATATCATGTCATCTTCCTTACTT
TGTTGTCCTTAATCAAGCAATAAATCTAGGGTCCGATTGAATGGACTTAAATCAAAATGGCAAAAAATAAAATAAAATTTGTGGCCGATACATTAACACAAGCTGTTTTATCATGTAGTT
ACAGCCAAAAAGAAGGGTAGCCTTAACATAATAAATTCTCAAATAATTATATTCGTAATCGTTTTATTTATTCCTTAAGTATATAGCAAGAATAGGTGAGTTCCGGTCTTTCTGGGTCCG
AGAGCATGTCCATCGCGCCTGCGTTTGACACCTTTCCTGGCTGTACTCACACGACGAATCTTCTGCACTAAATTCTCATTTTTCTTTTCTTTTCTCGGCTGCTAAAGATTTTCCGGGGAA
ATTTCAGTCCTCCCAATGGCGGAGAAAAACCGACGTAGATATGCATCGCGATTGGTGGCATGTAGCTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGC
GTAGACCACACCCGGTGCACGAAATTTCCCCGCGTGCTGTCCTGTTTCGGTGGTCACCGTCGCTGGGGGGTCTGTCGAGCTTTTTCTCGACCCGATCCCTCTTTTGTCTTTTCCGCCTCG
TCCCATCCCACGATTCCGATCCTAAAGAGACGCTCGTTGAATTCGAGAGTTTCCGTGATGGCGAACATGGGGAACGATGGGAAGCGCCAGACTTCGAGACTAACAACATCTCGTTTTCCT
TTAACTAAAACTGATGTCATCGTATGCGTGGAACGTTTCTTGCTTTTGGTCACATGCGACGGTGACGCATCGATTCCATGGATCGAGGGGCGGTGCCCATGTCATGCACAAAGCTTTCTA
CTCATGGCAGAAAAAAAGAGGAGGAAAAATCCCACTTAAAATGTAAATGACATGGGAGAAAAGTAAAATTTTACCGGCTTTAGCTTGCAATTTAGCCTGCAATTTAGCCCCTGAATTCTT
GGTGAAAATCGGATGCAGCTATGGCAACTGGAGACGCTGCTGCTACAGAAGGATACGTACCTAAACTACAGCCAGGCGCTGAGCTACACGAGCCAAGCGCTGAGCCAAAACCTGCAGGGC
CTGAGGAGGAGGAGCCGCATCAGGAGACTGAGCACCAAGTGCCTGTACTATCTGGAAGAGAACTGGAGGAGGATTTGGGTGGTGACCTTGTGGGTCATGATCATGATCGGCCTCTTCACC
TGGAAGTTCGTGCAGTACAAGCAGAAGGCCGCCTTCCAGGTCATGGGCTATTGCCTCCTCACGGCGAAGGGGGCCGCCGAGACGCTCAAGTTCAACATGGCCCTCATCCTGCTGCCGGTG
TGCCGGAACACCATCACTTGGCTCCGCAACACGAGGGTCGGCCTCTTCATACCCTTCGACGACAACATCAACTTTCACAAG
AGGTGCGCAAATTTTACCTCTTTCCTAACTTTTGATTTA
CTATATAGGCTATCTCAAATTCATGCCTAATGCTTTTCGTGAAATGCTGTATTATTACNNNNNNNNNNNNNNNNAACTTAGCTACATCCTCAATAGTGAACATTCCATATGTTGTGGATC
CAATCATGAACCGACAGCTCGAGCAACCCATGCCCAGTGCCCCTAATGCATGCTCCATGACTGATGTGCATATTTTTAAGCTTATAAAAATTTTGGAATAAATTAGGTCCGACGGATGGA
AATTAAACATGTCTAATCCATCCGTATGATTAAAAATTTCATCTTAATCACGGAACCTAACCCTCCTTTTTGAAATTTCCAATCCTTCGATTATTTTCCACATCATTTAGCTAGTTTTGT
CCTCCTATAGGCGGTGGAAACTTTGGTTGCACACAATTTTTTTCCCTTGGGGACCCACGAGGAGGATTTCTGGTGAAAGTCAACGTGATTGATTTGATCTGGACACTCGTTTTTTAAAGG
GAAAAAAAACTGATTCCTGATATGTCTCTTTGGGTGCACATAGATGACGACGATATGTCCTGTGTTAGAACGCGTATGGTGCAGTGCAAGGCATCATCTTTCTGCTTAAAGGCAGCAAAG
GTTGACAAATGAGAATCTTCCCTTGGGCCAGAGAGATCACGATTGTTTTTGTTTGTATGCAGAGAATTAGAAGAACTTGTGGAAAGCCATAAAGATTGACTCTTTCTTTTTCCTCCCCTT
AACGAGTTGAAAATTGAGAAAAAAACACGTGGAAAAGGAAACTCTGTTCAGCCTAAAATGATTCCTTGTGATGATTGCGTGTTAGTTTATAGACTATGAAGCTTTTGTTTATATGTATGA
GCTAGTTAAGCTAGGAGATTGACTTCTTAGCGACATAAAGAAAGTATCTCTTGCATTTCCCAAGATCCTTAAGAAGAAACTCTGTTTTGTGGCATTGTAAATTGGCAGGAGAGCAAGAAT
GCATCGATCATTGCTTGAATAAATTTCGATACAGAAAATCACAACTTAAAGCGTGACAAGATACAGATGTGATGCATAGAACAAATGTCGATTGTGATTTTCAGGTTCTGAACATGGAGA
GGAAGAGAGATTGGCTAATCAAATGATAGATTTTATTTTGCAATGTCATTCTAAGTGATAATGTCTGATATGATGCAAAATGCTGCTCAGATATGTAGAACTACGCATGTGATGGGGAAT
GACATTCCTAGGATCTTTTAGGTTGTCTGATTAGTGAAAAAGCAAGAATTCTGAGAAGAGAATGTTTTTTTTTTGAGGTCAGTGATCTTAGCGACGGAAGCAATGTCTCCACCATTTGCA
TAATTACCGGAGTCATGCTTTTTACTGATACTTTGGATTAACGAGAAACTGAAACGTTGTCCCCTTAGCCTAGCAGCTAGTGAATCATCAGTCATTAGTGATGGGATGATACTTGAGTTT
CAGGATTCATAGCAAGAATTGCAACATCTGAATAATATCTTTCTGGTTTGTACATTGGTGCAGACGATTGCTGCTGCTATTGTAGTTGGTGTCATCCTCCATGTGGGTGACCATCTTGCG
TGCGATTTTGTGAGGCTTGAACATGCGTCTAAAGACGTCTATCATAGATACTTGGAGGATGATTTTGGTAATCCGAAGCCGACGTACTTTGATCTTGTCAAGGGGATTGAAGGTGTGACT
GGGATCCTCATGGTGATCTTGATGTTAATAGCCTTCACATTGGCTACCCGATGGTTCCGCCGAAGCCTCGTCAAGTTACCGAAACCATTCGACCGGCTCACTGGTTTCAATGCATTTTGG
TACTCACACCACCTGTTCGTGCTCGTCTATATCCTGCTCATCATTCACGGAGTCTTCCTTTACCTCGTTCACCACTGGTACCGCAAGACG
CGGTACGAATCGTTTTCTTTCCCTGCATTC
CATGAACTTTCTGAGAATTAGGCATCTTCAATGTGCTGCGTTCTTTTTCCAACATTGAAATATTGAAAGACAGCTGGTGTATTCCTAACGTAGTCGCATCTAAGTCCGCAGGACTTGAGT
TTTGAAATGTGGAGTTTGTGTCCTTGCAGACGTGGATGTATCTTGCTGTTCCTGTATTGCTCTATGCCGGAGAAAGGACCCTGAGATTCTTCAGGTCTGGAATGTACACGGTCCGACTGC
TGAAGGTAACAAAAGCATTCCCGCGTCATCCANNNNNNNAATTTGATACTCATCTTCATTCGTTGGGCCTTCAATTAAAATTGTTGACATTTAGAGCGAATCGTCTTGATTGTTTAGGTT
GCGATCTACCCAGGAAATGTCTTGACGTTAAAGATGTCGAAGCCTCCCCAATTTAAGTACAAAAGCGGGCAGTACATGTTTGTCCAGTGTCCTGCGGTTTCTCCATTCGAGTG
TGGTAAG
TCCCCAAGTAATGACGATAAGTGTCACTGAGGACAATGCATTTTGCTTATGGTAATGGCCTTCTTGAGCGGACTGCTCAACTGCATATGGTCTCCTCGCATACATACTGATCTCTTCTCC
CGACACACATTGCCAGGCACCCATTTTCGATAACCTCAGCTCCCGGTGACGACTTCCTCAGTGTTCACATCCGTCAACTTGGCGACTGGACGCAAGAGCTCAAAAGGGTGTTCGCCGAGG
CTTGTGAGCCTCCTGTTGCAGGAAAGAGTGGCCTCCTCAGGGCTGATGAAACAACCAAGAAAAG
AGGTGCGCACACTTCCTGTTCCATTCTTTCGTTGTCCACAAGCTATAATTTTCCGA
TAACTGAACATGAGCTTCTGGAATTAATGATAATCAAGACCACATTCCTTTGTTGATTACAGTTTGCCGAAGCTCTGCATAGACGGCCCATATGGCGCTCCAGCACAAGACTACAAAAAA
TACGATGTGTTGCTGCTGGTTGGTCTCGGAATTGGGGCAACGCCTTTCATTAGTATCCTCAAAGATTTAATCAACACCATTGTCAAAAGCGAGGAGCAAGCA
CAGTAAGTACTACATACT
CTTTAACTTTTTAATTACCTTTCGAACAACATGATCGTGGACTGATGATGCAAATGAGAATGAATTGGCATTGTACCTGTGAGAATTCAAGACCAATTTTCCTTTTGCCTCCTTTCTTTG
TTTGCAGGACTCAGTCACAGATGTCAGTAGGAACTCGGATTTAAGCATCGGGAGCGTTGAGTCACCTGGCCCGAACCGGGTCTCCCCAAGGCGCAGGAAGACTCTGAAAACCACCAATGC
GTACTTCTACTGGGTGACGAGAGAACAAGGGTCGTTCGATTGGTTCAAGGGGGTCATGAATGAGGTCGCGGAGATTGACCAAAGG
GGGTAAGAAAGAGTGCTTTCTCTTGAGCCCAATTT
TCAGCTCATTAATCGAATTGATTGAAGTTTTGTCTTTACTGATCACGTTCTGGTGTGGGACTTCTAGGGGGTGATTGAGATGCACAATTATTTGACCAGTGTGTACGAGGAAGGTGATGC
AAGATCAGCTCTCATCACTATGGTCCAAGCTCTTAATCATGCCAAGAATGGGATAGACATTGTGTCTGGGACAACG
CGGTAAGTATCCTTCTTCCTCTTCTTCTTTTGTCAATTTAATAT
TTGTTGTTTTCTTTTCCAATCCACAACCGTACGTCACATCCTGAATCGCAAAATGGAAACGTTTGCATTCAGGTAAGGACTCATTTTGCAAGACCCAACAGGAAAAAGGCTTTCAATAAA
CTATGCTCCAAGCACAGCGGTGCAAGAATAG
AGGTAATTCTCAACCCAGTTGAATCACAGAAGCTACTTAATCAATCTTCAAATATTCAATTTTTATTCCTTCTTTTTTTGGGTTTCCTT
GAATCAGGTGTTTTCTACTGTGGAGCGCCTGTTCTGGCCAAGGAGCTGAGCAAGCTCTGCTACGAATTCAACCAGAAAGGCCCCACCAAATTCGACTTCCACAAGGAGCATTTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGGCCTCGCCAAGCACGGGCGCCGGTGGGCGTCGGACACCGTCCCCGGCAAGTCACCGGCCAGCGACAGCACTTCGCCGGCGGGTACGGAGGCCAGCTACGGCGAGGAGCTCGTG
GAGGTGACCCTC
GCCGGCGGCTTCGACGTGGCCCTGGCGGCCCGGGCCCTGCGGAAGCAGCGCGCGCAGCTCGACCGGAACCGCTCGGGCGCCCAAAAGGCCTTGCGCGGGCTGCGGTTC
ATCAGCAACAGCAAGACCAACTGCAGCATCGATGCATGGAACGAAATTCAGGCTAGCTTCGATAAGCTTGCCAAAGATGGTTGTCTCTATCGTCAAGATTTCGCACAATGCATAG
GAATG
AAAGATTCGAAGGAGTTTGCTTTGGAACTGTTCGATGCATTGGGGAGGAGGAGGAGAATGAAGGTCGACAGGATCAGCAAAGACGAGCTCCACGAGTTCTGGTGTCAGATCACTGATCAG
AGCTTCGATTCACGTCTCCAGATCTTCTTCGACAT
GGTAGACAAGAACGAGGACGGAAGAATCACCGGAGAAGAAGTAAAAGAGATCATAATGCTGAGCGCCTCGGCGAATCGATTATCG
AGGTTGAAGGAGCAGGCGGAGGAGTACGCAGCTCTGATCATGGAAGAACTGGATCCGGAGCAGCTCGGCTACATCGAG
CTATGGCAACTGGAGACGCTGCTGCTACAGAAGGATACGTAC
CTAAACTACAGCCAGGCGCTGAGCTACACGAGCCAAGCGCTGAGCCAAAACCTGCAGGGCCTGAGGAGGAGGAGCCGCATCAGGAGACTGAGCACCAAGTGCCTGTACTATCTGGAAGAG
AACTGGAGGAGGATTTGGGTGGTGACCTTGTGGGTCATGATCATGATCGGCCTCTTCACCTGGAAGTTCGTGCAGTACAAGCAGAAGGCCGCCTTCCAGGTCATGGGCTATTGCCTCCTC
ACGGCGAAGGGGGCCGCCGAGACGCTCAAGTTCAACATGGCCCTCATCCTGCTGCCGGTGTGCCGGAACACCATCACTTGGCTCCGCAACACGAGGGTCGGCCTCTTCATACCCTTCGAC
GACAACATCAACTTTCACAAG
ACGATTGCTGCTGCTATTGTAGTTGGTGTCATCCTCCATGTGGGTGACCATCTTGCGTGCGATTTTGTGAGGCTTGAACATGCGTCTAAAGACGTCTAT
CATAGATACTTGGAGGATGATTTTGGTAATCCGAAGCCGACGTACTTTGATCTTGTCAAGGGGATTGAAGGTGTGACTGGGATCCTCATGGTGATCTTGATGTTAATAGCCTTCACATTG
GCTACCCGATGGTTCCGCCGAAGCCTCGTCAAGTTACCGAAACCATTCGACCGGCTCACTGGTTTCAATGCATTTTGGTACTCACACCACCTGTTCGTGCTCGTCTATATCCTGCTCATC
ATTCACGGAGTCTTCCTTTACCTCGTTCACCACTGGTACCGCAAGACG
GTTGCGATCTACCCAGGAAATGTCTTGACGTTAAAGATGTCGAAGCCTCCCCAATTTAAGTACAAAAGCGGG
CAGTACATGTTTGTCCAGTGTCCTGCGGTTTCTCCATTCGAGTG
GCACCCATTTTCGATAACCTCAGCTCCCGGTGACGACTTCCTCAGTGTTCACATCCGTCAACTTGGCGACTGGACG
CAAGAGCTCAAAAGGGTGTTCGCCGAGGCTTGTGAGCCTCCTGTTGCAGGAAAGAGTGGCCTCCTCAGGGCTGATGAAACAACCAAGAAAAG
TTTGCCGAAGCTCTGCATAGACGGCCCA
TATGGCGCTCCAGCACAAGACTACAAAAAATACGATGTGTTGCTGCTGGTTGGTCTCGGAATTGGGGCAACGCCTTTCATTAGTATCCTCAAAGATTTAATCAACACCATTGTCAAAAGC
GAGGAGCAAGCA
GACTCAGTCACAGATGTCAGTAGGAACTCGGATTTAAGCATCGGGAGCGTTGAGTCACCTGGCCCGAACCGGGTCTCCCCAAGGCGCAGGAAGACTCTGAAAACCACC
AATGCGTACTTCTACTGGGTGACGAGAGAACAAGGGTCGTTCGATTGGTTCAAGGGGGTCATGAATGAGGTCGCGGAGATTGACCAAAGG
GGGGTGATTGAGATGCACAATTATTTGACC
AGTGTGTACGAGGAAGGTGATGCAAGATCAGCTCTCATCACTATGGTCCAAGCTCTTAATCATGCCAAGAATGGGATAGACATTGTGTCTGGGACAACG
GTAAGGACTCATTTTGCAAGA
CCCAACAGGAAAAAGGCTTTCAATAAACTATGCTCCAAGCACAGCGGTGCAAGAATAG
GTGTTTTCTACTGTGGAGCGCCTGTTCTGGCCAAGGAGCTGAGCAAGCTCTGCTACGAATTC
AACCAGAAAGGCCCCACCAAATTCGACTTCCACAAGGAGCATTTCTAA

Retrieve as FASTA