Entry information : EglRboh03
Entry ID 11034
Creation 2012-05-18 (Qiang Li)
Last sequence changes 2012-05-18 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-16 (Christophe Dunand)
Peroxidase information: EglRboh03
Name EglRboh03
Class Respiratory burst oxidase homolog    [Orthogroup: Rboh003]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglRboh03
start..stop
S start..stop
EgrRboh03 1651 0 29..814 13..798
EguRboh03 1617 0 29..814 13..798
EcamRboh03 1170 0 1..603 1..604
EcamRboh03 216 2.68e-60 710..814 574..678
JregRboh08 1165 0 17..814 6..803
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11034' 'join(1..292,406..568,670..718,800..913,995..1801,1928..2023,2126..2241,2333..2435,2574..2665,2749..2908,2994..3128,3229..3357,3453..3531,3685..3794)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..292 290 N° 2 406..568 161 N° 3 670..718 47 N° 4 800..913 112
N° 5 995..1801 805 N° 6 1928..2023 94 N° 7 2126..2241 114 N° 8 2333..2435 101
N° 9 2574..2665 90 N° 10 2749..2908 158 N° 11 2994..3128 133 N° 12 3229..3357 127
N° 13 3453..3531 77 N° 14 3685..3794 108  
join(1..292,406..568,670..718,800..913,995..1801,1928..2023,2126..2241,2333..243 5,2574..2665,2749..2908,2994..3128,3229..3357,3453..3531,3685..3794)


exon

Literature and cross-references EglRboh03
Protein sequence: EglRboh03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   814 (307)
PWM (Da):   %s   93291.47 (33809.9) Transmb domain:   %s   i261-280o347-369i397-419o445-467i633-650o
PI (pH):   %s   9.84 (6.98) Peptide Signal:   %s   cut: 25 range:25-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDNAVETSESSAPPHPNDIPLPSRRNSSTTRKRNVSYGGIPRMER
TASSASRGLMSLRFLDRTITGKEGDAWRSIEKRFHQHATNGQLSRDKFGVCI
GMGDSKEFAGELFDALSRRRKVNAENGISIDQLRQFWEDMTTRELESRLQIFFDMCDKNGDGRLTEDEVKVIVLSAASNRLSNLQQQAASHASLIMERLDPDHQGYIEMWQLKTLLREMV
NPDQRSKSSVNSQNLTRTMLPKGYRNPMSRLVHKNIERIHDNWRRIWVVGLWLVANMILFLWKFNKTRHGPAFDITGYCLCYAKGSAETLNLNMALVLLPVCRRTLTKLRSSFLGTFIPF
DDNINFHKIIALAIAIGSVVHIAMHFMCNFPRITSCPKSQFKQVFGPYFHNRQPHYIDLVNNLSSTTGVLMFMMMAFSFTLATHWFRRNIIKLPWGLHHLAGFNAFWYAHHLLAVAYVFF
ILHGYFLVISRPWYTKT
AWMYVMVPILLYTSERAFTSASELQHRVDIVKAIVYSGNVLALYMSKPPGFNYNSGMYLFVKCPDISKFEWHPFSITSAPGDAFLSVHMRALGDWTTELRNRF
A
VCEPPSKKPGKGGLTKMATRTSHNLEELQEKFPKIFIKGPYGAPAQDYEKYDILLLIGLGIGATPFISIIKDILNHVKLNKLQDSDQDQSSGARKGPKRAYFYWVTREQNSFEWFKGVM
DDIAERDDH
NVIEMHNYLTSLYEEGDARSALIAMVQKLQHAKNGVDIFSESQIKTHFARPNWRKVFSEIAMRHKSSRIGVFYCGSSVLTKTLRKLCQELSLESSTRFQFHKENF

Retrieve as FASTA  
Remarks Complete sequence from NGS. First exon is probably missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACAATGCGGTGGAAACCAGTGAGAGCTCCGCCCCGCCGCATCCTAATGACATACCATTGCCATCGAGGCGGAACTCAAGCACGACGCGGAAGAGGAATGTATCGTACGGCGGCATC
CCTAGGATGGAAAGAACGGCATCCAGTGCCTCTCGAGGCCTCATGAGCTTGAGGTTTCTGGATAGGACAATTACCGGGAAGGAAGGAGATGCCTGGAGATCAATCGAGAAGCGTTTCCAT
CAACACGCGACGAACGGCCAACTCTCGAGAGACAAATTTGGAGTCTGCATTG
TGGTTGATCCTTAGAAAGTCTTGCTGCTATCTGAATCATGATTTTCCAGATAATAATAATAATAATAA
TTGCACAATTTGATTGAGAAGTGACATTGTTTTATTCTGCGTGGAAGGAATGGGAGATTCCAAGGAATTTGCAGGAGAGTTATTCGACGCCTTATCAAGACGGAGGAAAGTGAATGCCGA
GAATGGAATATCAATAGACCAATTGAGACAATTTTGGGAAGACATGACGACTCGAGAACTCGAATCCCGACTGCAGATATTCTTTGATAT
ATGTAAAGCAACTCTCGTCCATCTCCTATT
ATCGTTCGCAACCTAAAGCGTACATTGCGTTGCTGGTAATACATGTGATGAAGTTTCGCGACGAATGCTGCAGGTGTGACAAGAATGGTGATGGGAGGCTAACTGAGGATGAGGTAAAAG
AG
AGGTGAGGCAAAAGGAGACTTACTAATCACTCGTTTAGCGTGTCCTTTGGGCTCTTTTATGATGGACTGGAAATTTTTCAAAGGTGATAGTGTTGAGCGCCGCCTCGAATAGGCTGTC
AAATCTCCAGCAGCAAGCGGCATCTCACGCATCTCTGATCATGGAAAGACTTGATCCCGACCATCAAGGATACATCGAG
AGGTACCGAGTCAGATAGTCCATCATGTCCTGTTCGAGTTC
GTGTTCCTCCCATGTTGTTGTTCATCGCTTCTTTGTTTTCAGATGTGGCAATTAAAGACTCTCCTGAGAGAAATGGTGAACCCTGATCAAAGGAGCAAGTCGTCAGTGAATTCTCAAAAC
CTGACCAGAACCATGCTTCCCAAAGGATACAGAAACCCAATGAGTCGGCTCGTGCACAAGAACATCGAAAGGATCCATGACAATTGGAGGCGAATATGGGTCGTCGGGCTGTGGCTGGTC
GCAAACATGATCCTCTTCCTTTGGAAGTTTAACAAAACGAGGCACGGCCCCGCCTTTGACATCACGGGCTATTGTCTTTGCTACGCCAAGGGCTCTGCCGAGACACTCAATCTCAACATG
GCTCTCGTCCTCCTCCCCGTATGCAGAAGAACTCTCACGAAGCTACGCTCGTCCTTCCTTGGTACCTTCATACCATTCGACGACAACATAAACTTCCACAAGATAATCGCGCTGGCCATA
GCTATAGGATCTGTCGTTCACATTGCAATGCATTTTATGTGCAACTTCCCCAGGATAACTTCCTGCCCAAAATCACAATTCAAGCAAGTGTTTGGCCCGTACTTCCATAATAGGCAACCT
CATTACATCGACTTGGTCAATAACTTGTCCAGCACCACCGGGGTTCTCATGTTCATGATGATGGCCTTCTCTTTCACACTGGCGACTCATTGGTTCAGGAGAAACATCATCAAGCTACCG
TGGGGGCTCCATCATTTAGCAGGATTTAATGCCTTCTGGTACGCACATCATTTGCTAGCCGTTGCCTATGTCTTCTTCATACTTCACGGCTACTTCCTCGTGATCAGTCGACCTTGGTAC
ACGAAAACG
CGGTAAGTACACAATGGTCTAATTCCTTATTCTGTTCACCATTAATTCATAAGGCCTGAATTCTCCGGTCGTACCATCATTCCTCTGAAAACACGGCAAGAATCATTATAC
GGTTGGACTTTATGCAGGCATGGATGTATGTGATGGTCCCAATCCTACTCTACACAAGCGAGAGAGCATTCACATCTGCTTCTGAACTCCAACATCGAGTTGATATCGTTAAGAGGTATC
ACTCACTTTACCGAACTGCCGTGTTCCACATTCCTTTTTGGTTTACACGAATCTTAGTGCTACGATAAATTCATGCTCGGCTCAAAAAACTTTTCAGGCCATTGTTTATTCTGGAAACGT
CCTTGCATTGTACATGAGCAAGCCTCCAGGTTTCAACTACAACAGCGGAATGTACCTTTTCGTCAAATGCCCTGATATATCAAAGTTCGAATG
TGGTGTATAGAACATAATCGCTGAAAC
CTATTTACTCGTCATACCCCTATGGCTTTTATTGCTGAAACTCATCGGTGTTTTTGCTCGGGACAGGCATCCTTTCTCCATTACTTCCGCACCGGGAGATGCCTTCTTGAGTGTTCACAT
GCGAGCCTTGGGCGATTGGACTACAGAGCTCAGGAATAGATTCGCCGAG
AGGTATATTCTATTGATTTTCTCATTCGTTTTTAGATTGCACAACCCATGGACTCTAGTCGAAAGATATAA
AAAAATCACCACATTTTCCATGTTGAGTATCGAACTCAATGTTCATCTTCTTCAATGAGAAATTGTTAGGTTTGTGAGCCACCAAGTAAAAAACCAGGGAAGGGAGGTCTAACGAAGATG
GCCACGAGAACATCCCACAACTTGGAAGAGTTACAAGAGAA
AAGTGAGTGAAAATTATGGCTAAATTCTGTCCCACCCCTTCCATGCAAATGCTTTCGCTCTAACAGATATTCATTGTTG
TCCAAGGTTTCCAAAGATTTTCATCAAGGGGCCATACGGTGCTCCGGCTCAGGACTACGAGAAGTATGACATCCTCCTACTCATCGGTCTTGGCATCGGAGCGACTCCTTTCATCAGCAT
CATAAAAGATATCCTGAATCACGTCAAGTTGAATAAGCTCCAAGCA
CAGTAAGTAGAAAAGGGAAAAACACTCGCACAAGCAATTTCAAATTCAGTTAGCACGACCATTTGCCAAAACTA
TTGATGCATGCAGGATTCGGATCAAGATCAATCATCAGGGGCAAGAAAAGGTCCTAAAAGAGCATACTTTTACTGGGTTACGAGGGAACAAAACTCTTTCGAGTGGTTCAAGGGCGTCAT
GGATGATATTGCAGAAAGAGACGATCAT
ATGTCGGTTCGCCATTTCCAAAACTACCAAGTGTGATGAATCCTCCAATTAATTATAGTTTTTCAACTAAAATGTCGCTTTGGGTACTGGTG
ATTGTTGTAGAATGTAATAGAGATGCACAACTACCTGACCTCTCTATATGAGGAAGGAGATGCGAGATCAGCACTCATTGCCATGGTCCAAAAGTTGCAGCACGCGAAGAATGGTGTCGA
CATCTTCTCGGAAAGTCAG
AGGTAACTCTTGATCAGTCACACAAAAGAAAAACAAAGAAACATTCACAGCACAATGCACCTATTTAGGCTGTCCTTTAACGTTGCTTGTTCGACAGATAA
AAACTCACTTTGCGAGGCCTAATTGGAGAAAGGTGTTCTCTGAAATTGCAATGCGGCACAAGTCGTCTCGTATAG
AGGTACGACATCACGTCCGATGAACGTGTCAACATAATGGCACTT
GATTTGGTTGTTCTAGCCAGTTTGGAACATGAACCTGTGATTTTCTAACTGTTGGAACTTGAACATTCTACCAATTCGGGTCTGATATGTCGGTAATAATTTTCCTGCAGGTGTTTTCTA
TTGTGGGAGTTCGGTGCTCACCAAAACACTGAGGAAGCTATGTCAAGAACTCAGCCTAGAGTCGTCAACTCGCTTCCAATTCCACAAGGAAAACTTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACAATGCGGTGGAAACCAGTGAGAGCTCCGCCCCGCCGCATCCTAATGACATACCATTGCCATCGAGGCGGAACTCAAGCACGACGCGGAAGAGGAATGTATCGTACGGCGGCATC
CCTAGGATGGAAAGAACGGCATCCAGTGCCTCTCGAGGCCTCATGAGCTTGAGGTTTCTGGATAGGACAATTACCGGGAAGGAAGGAGATGCCTGGAGATCAATCGAGAAGCGTTTCCAT
CAACACGCGACGAACGGCCAACTCTCGAGAGACAAATTTGGAGTCTGCATTG
GAATGGGAGATTCCAAGGAATTTGCAGGAGAGTTATTCGACGCCTTATCAAGACGGAGGAAAGTGAAT
GCCGAGAATGGAATATCAATAGACCAATTGAGACAATTTTGGGAAGACATGACGACTCGAGAACTCGAATCCCGACTGCAGATATTCTTTGATAT
GTGTGACAAGAATGGTGATGGGAGG
CTAACTGAGGATGAGGTAAAAGAG
GTGATAGTGTTGAGCGCCGCCTCGAATAGGCTGTCAAATCTCCAGCAGCAAGCGGCATCTCACGCATCTCTGATCATGGAAAGACTTGATCCCGAC
CATCAAGGATACATCGAG
ATGTGGCAATTAAAGACTCTCCTGAGAGAAATGGTGAACCCTGATCAAAGGAGCAAGTCGTCAGTGAATTCTCAAAACCTGACCAGAACCATGCTTCCCAAA
GGATACAGAAACCCAATGAGTCGGCTCGTGCACAAGAACATCGAAAGGATCCATGACAATTGGAGGCGAATATGGGTCGTCGGGCTGTGGCTGGTCGCAAACATGATCCTCTTCCTTTGG
AAGTTTAACAAAACGAGGCACGGCCCCGCCTTTGACATCACGGGCTATTGTCTTTGCTACGCCAAGGGCTCTGCCGAGACACTCAATCTCAACATGGCTCTCGTCCTCCTCCCCGTATGC
AGAAGAACTCTCACGAAGCTACGCTCGTCCTTCCTTGGTACCTTCATACCATTCGACGACAACATAAACTTCCACAAGATAATCGCGCTGGCCATAGCTATAGGATCTGTCGTTCACATT
GCAATGCATTTTATGTGCAACTTCCCCAGGATAACTTCCTGCCCAAAATCACAATTCAAGCAAGTGTTTGGCCCGTACTTCCATAATAGGCAACCTCATTACATCGACTTGGTCAATAAC
TTGTCCAGCACCACCGGGGTTCTCATGTTCATGATGATGGCCTTCTCTTTCACACTGGCGACTCATTGGTTCAGGAGAAACATCATCAAGCTACCGTGGGGGCTCCATCATTTAGCAGGA
TTTAATGCCTTCTGGTACGCACATCATTTGCTAGCCGTTGCCTATGTCTTCTTCATACTTCACGGCTACTTCCTCGTGATCAGTCGACCTTGGTACACGAAAACG
GCATGGATGTATGTG
ATGGTCCCAATCCTACTCTACACAAGCGAGAGAGCATTCACATCTGCTTCTGAACTCCAACATCGAGTTGATATCGTTAAG
GCCATTGTTTATTCTGGAAACGTCCTTGCATTGTACATG
AGCAAGCCTCCAGGTTTCAACTACAACAGCGGAATGTACCTTTTCGTCAAATGCCCTGATATATCAAAGTTCGAATG
GCATCCTTTCTCCATTACTTCCGCACCGGGAGATGCCTTCTTG
AGTGTTCACATGCGAGCCTTGGGCGATTGGACTACAGAGCTCAGGAATAGATTCGCCGAG
GTTTGTGAGCCACCAAGTAAAAAACCAGGGAAGGGAGGTCTAACGAAGATGGCCACGAGA
ACATCCCACAACTTGGAAGAGTTACAAGAGAA
GTTTCCAAAGATTTTCATCAAGGGGCCATACGGTGCTCCGGCTCAGGACTACGAGAAGTATGACATCCTCCTACTCATCGGTCTTGGC
ATCGGAGCGACTCCTTTCATCAGCATCATAAAAGATATCCTGAATCACGTCAAGTTGAATAAGCTCCAAGCA
GATTCGGATCAAGATCAATCATCAGGGGCAAGAAAAGGTCCTAAAAGA
GCATACTTTTACTGGGTTACGAGGGAACAAAACTCTTTCGAGTGGTTCAAGGGCGTCATGGATGATATTGCAGAAAGAGACGATCAT
AATGTAATAGAGATGCACAACTACCTGACCTCT
CTATATGAGGAAGGAGATGCGAGATCAGCACTCATTGCCATGGTCCAAAAGTTGCAGCACGCGAAGAATGGTGTCGACATCTTCTCGGAAAGTCAG
ATAAAAACTCACTTTGCGAGGCCT
AATTGGAGAAAGGTGTTCTCTGAAATTGCAATGCGGCACAAGTCGTCTCGTATAG
GTGTTTTCTATTGTGGGAGTTCGGTGCTCACCAAAACACTGAGGAAGCTATGTCAAGAACTCAGC
CTAGAGTCGTCAACTCGCTTCCAATTCCACAAGGAAAACTTTTAG

Retrieve as FASTA