Entry information : CnGPx02_grubiiH99
Entry ID 11049
Creation 2012-05-21 (Catherine Mathe)
Last sequence changes 2012-05-21 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-27 (Christophe Dunand)
Peroxidase information: CnGPx02_grubiiH99
Name CnGPx02_grubiiH99
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Tremellomycetes Tremellaceae Filobasidiella
Organism Cryptococcus neoformans (Filobasidiella neoformans)    [TaxId: 5207 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CnGPx02_grubiiH99
start..stop
S start..stop
CnGPx02_JEC21 370 1.92e-133 1..185 1..185
CgaGPx02 360 1.39e-129 1..185 1..185
DcryGPx02 275 4.84e-96 11..185 7..183
DcryGPx03 274 1.09e-95 11..185 7..183
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11049' 'complement(join(144224..144329,144404..144540,144616..144757,144827..144876,144939..145061))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 144939..145061 121 N° 2 144827..144876 48 N° 3 144616..144757 140 N° 4 144404..144540 135
N° 5 144224..144329 104  
complement(join(144224..144329,144404..144540,144616..144757,144827..144876,1449 39..145061))


exon

Literature and cross-references CnGPx02_grubiiH99
DNA ref. JGI genome:   cneoH99_Chr6 (145061..144224)
Protein sequence: CnGPx02_grubiiH99
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   185
PWM (Da):   %s   20211.29  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFFDSIASKFGYESLPGDIATKSFYDLKAKLPGSKGDLDFSTLKGKVVLIVNTASKCGFTPQYNGLEELHKTYGDKGLVVLGFPSNEFGGQEPGSDDDIAQFCTLNHGVTFPLMKKSEV
NGKNMNEVFAWLKSQKGENVGGLAGTTAIKWNFTKFLVNKEGKCVGRYGSSTKPEKLKEEIEKLL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Strain="H99", variety="grubii".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATTTTTCGACAGCATCGCCTCCAAGTTTGGTTATGAATCTCTCCCAGGGGACATTGCCACCAAGAGCTTCTACGATTTGAAGGCCAAGCTGCCTGGGAGCAAAGGTGATTTGGAC
TTT
GTAAGTACTCTTTTTTCATGTATCATCTGATAAGGGAATAAGTACTTATACGATATGTGCAGTCTCTACTTTGAAAGGCAAGGTTGTCTTGATCGTCAACACTGCTTCCAAATGGCA
AGTCATTTCCTTTTATAAACGTCGGTTGAAACCAGTATAAGAGCTGACTTGTGTTTTGATGTGTAGTGTGGTTTCACTCCCCAGTATAACGGCCTTGAAGAGCTTCACAAAACTTACGGA
GACAAGGGTCTTGTCGTCCTTGGTTTCCCTTCCAATGAGTTTGGAGGACAAGAGCCTGGTTCTGATGATGATATCGCCCAGTTTTGTACC
GTGAGTCTCCCGCCACATCTCACTTTCGAC
GTGTGGGCCAGTAGGTAGTGACTGACATCAAACCATTTATTGCAGCTCTCAACCATGGTGTCACTTTCCCTCTTATGAAGAAGTCTGAAGTGAACGGGAAGAACATGAATGAGGTCTTTG
CGTGGTTGAAGTCTCAGAAGGGAGAGAACGTCGGTGGTCTTGCCGGGACTACTGCCATCAAGTG
GTACGTCCTCCTTTTTGTTTCTTCGAATATATAGAGTCATATCAGTCAGAGCTGAC
ATCCGAGCCTTTACATAGGAGAACTTTACCAAATTCCTTGTCAACAAGGAGGGCAAATGTGTTGGCCGATATGGTTCTTCCACCAAGCCCGAGAAGCTCAAGGAAGAAATCGAGAAGCTT
CTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACATTTTTCGACAGCATCGCCTCCAAGTTTGGTTATGAATCTCTCCCAGGGGACATTGCCACCAAGAGCTTCTACGATTTGAAGGCCAAGCTGCCTGGGAGCAAAGGTGATTTGGAC
TTT
TCTACTTTGAAAGGCAAGGTTGTCTTGATCGTCAACACTGCTTCCAAATGTGGTTTCACTCCCCAGTATAACGGCCTTGAAGAGCTTCACAAAACTTACGGAGACAAGGGTCTTGTC
GTCCTTGGTTTCCCTTCCAATGAGTTTGGAGGACAAGAGCCTGGTTCTGATGATGATATCGCCCAGTTTTGTACC
CTCAACCATGGTGTCACTTTCCCTCTTATGAAGAAGTCTGAAGTG
AACGGGAAGAACATGAATGAGGTCTTTGCGTGGTTGAAGTCTCAGAAGGGAGAGAACGTCGGTGGTCTTGCCGGGACTACTGCCATCAAGTG
GAACTTTACCAAATTCCTTGTCAACAAG
GAGGGCAAATGTGTTGGCCGATATGGTTCTTCCACCAAGCCCGAGAAGCTCAAGGAAGAAATCGAGAAGCTTCTCTAA

Retrieve as FASTA