Entry information : EglPrxQ01
Entry ID 11054
Creation 2012-05-21 (Qiang Li)
Last sequence changes 2012-05-21 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2015-10-27 (Christophe Dunand)
Peroxidase information: EglPrxQ01
Name EglPrxQ01
Class Atypical 2-Cysteine peroxiredoxin (type Q)     [Orthogroup: PrxQ001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrxQ01
start..stop
S start..stop
EgrPrxQ01 539 0 1..268 29..296
EguPrxQ01 479 2e-173 10..268 38..296
EcamPrxQ01 477 1e-172 11..268 40..298
PtPrxQ01 345 6e-122 56..267 1..212
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..360 360 N° 2 460..597 138 N° 3 1016..1105 90 N° 4 1324..1539 216
join(1..360,460..597,1016..1105,1324..1539)


exon

Literature and cross-references EglPrxQ01
Protein sequence: EglPrxQ01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   268 (265)
PWM (Da):   %s   29267.41 (28716.9) Transmb domain:   %s   i29-51o
PI (pH):   %s   10.7 (8.46) Peptide Signal:   %s   cut: 27 range:27-291
Sequence 309
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
KNTGRRRRRNATLADPVASRGAQHSSKRIICLPFSLIFLGPFFFIPSSALILSSTMATLSLPKHSLPSLLPPQTPRTQSPRTPTFLPKSTQSQFHGLKLSNSSSPSVPSSFSAKSTVFAKVNKGQAPPAFTLKDQDGKTVSLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYRLPFTLLSDVGDKVRKDWGVPSDLFGALPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQSA

Retrieve as FASTA  
Remarks Partial sequence from genomic. First exon is missing. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAACACAGGAAGAAGAAGAAGAAGAAACGCAACGCTTGCTGATCCGGTCGCAAGCAGAGGCGCACAGCACAGCAGCAAAAGAATAATCTGTTTGCCCTTTTCTCTTATTTTTCTTGGGC
CTTTCTTTTTTATCCCTTCATCTGCTCTGATTCTGAGCTCAACGATGGCCACGCTTTCCCTCCCGAAGCACTCCCTCCCGTCTCTGCTCCCACCTCAGACGCCCAGAACCCAATCTCCCC
GGACCCCAACGTTCTTGCCCAAGTCGACGCAGTCTCAGTTCCACGGCCTTAAGCTGTCCAATTCCTCCTCTCCCTCCGTCCCTTCTTCCTTCTCCGCCAAGAGCACCGTCTTTGCCAAG
G
TACATTGTCCCACGTCCAGAGATTTGGAGGCATTTGGAGGGCTAAGCCAAGAGGGTTACTAATGTCTTCCCGTTTCTGTTTGTGGAAACTTCCTGCAGGTGAACAAAGGCCAAGCCCCGC
CAGCCTTCACGCTGAAGGATCAGGACGGCAAGACCGTGAGCCTCTCTAAGTTCAAGGGCAAGCCCGTCGTCGTCTATTTCTACCCTGCTGACGAGACGCCAGGTTGCACCAAGCAG
GTAA
CTTGAACGACCTGCTCTTCCGGTGTTCTTTTTTGTTGGTTTGTGGGGGAGATTCAAGTGGTTGGTCCTGTTGGACAATGGCAATCCGTGATAAGGGGCATNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNTTCACAATCACTTGTCTTTCTCTCTCTTTTGCCGAATATGGTGGTGAAATGAGTATGCTCTGAGCTAGACTGCGCCCAATTGCTTTACTTTCTTTGAAAGAATT
TGAGTACAATGTGTTGAGTTGCTCAGTGTAGCTAATAGCTATTGATAGATAGAGATGAATTCAGCGATTTCTCCNNNNNNNNNNNNNNNNNNNNNNNNCTAGACATTGCTGAATCGACCG
CAGGGAATTTTCCTTGTGAAGAATTGGGTTTACTAAGCATGCCGTTTCTGTCAGGCCTGCGCTTTCAGGGATTCTTATGAGAAGTTCAAGAAAGCAGGAGCTGAGGTGGTTGGAATCAGT
GGGGACGACTCGTCTTCGCATAAG
GTATTGGACAAAGTTCATCTGTTTCCTGTAATTGATTATGTGTTTGCATCATTTGAGCTTTTGGAAAATTAATGCTGAAAGCTGTAGGAACAAGTG
ATAGATTTGTCAGGAATGTTTAAGTCTTTCTGGGTACATGTTTAATGAAACTGCAATACTCGGATTTTGCACCAAAATGCTAATGTTTCGCTGCTGACAATGAGTTTCATTGTTAACGTC
AGGCATTCGCCAAGAAGTATAGACTTCCATTCACATTGCTCAGCGATGTCGGGGATAAGGTCAGGAAAGATTGGGGAGTCCCCTCGGATTTATTTGGGGCATTGCCTGGAAGACAGACTT
ACGTACTCGACAAGAATGGTGTGGTTCAGCTCATTTACAACAACCAATTCCAACCTGAGAAGCACATCGACGAGACCTTGAAGTTCCTTCAGAGTGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAACACAGGAAGAAGAAGAAGAAGAAACGCAACGCTTGCTGATCCGGTCGCAAGCAGAGGCGCACAGCACAGCAGCAAAAGAATAATCTGTTTGCCCTTTTCTCTTATTTTTCTTGGGC
CTTTCTTTTTTATCCCTTCATCTGCTCTGATTCTGAGCTCAACGATGGCCACGCTTTCCCTCCCGAAGCACTCCCTCCCGTCTCTGCTCCCACCTCAGACGCCCAGAACCCAATCTCCCC
GGACCCCAACGTTCTTGCCCAAGTCGACGCAGTCTCAGTTCCACGGCCTTAAGCTGTCCAATTCCTCCTCTCCCTCCGTCCCTTCTTCCTTCTCCGCCAAGAGCACCGTCTTTGCCAAG
G
TGAACAAAGGCCAAGCCCCGCCAGCCTTCACGCTGAAGGATCAGGACGGCAAGACCGTGAGCCTCTCTAAGTTCAAGGGCAAGCCCGTCGTCGTCTATTTCTACCCTGCTGACGAGACGC
CAGGTTGCACCAAGCAG
GCCTGCGCTTTCAGGGATTCTTATGAGAAGTTCAAGAAAGCAGGAGCTGAGGTGGTTGGAATCAGTGGGGACGACTCGTCTTCGCATAAGGCATTCGCCAAGA
AGTATAGACTTCCATTCACATTGCTCAGCGATGTCGGGGATAAGGTCAGGAAAGATTGGGGAGTCCCCTCGGATTTATTTGGGGCATTGCCTGGAAGACAGACTTACGTACTCGACAAGA
ATGGTGTGGTTCAGCTCATTTACAACAACCAATTCCAACCTGAGAAGCACATCGACGAGACCTTGAAGTTCCTTCAGAGTGCC

Retrieve as FASTA