Entry information : CheGPx01_C5
Entry ID 11061
Creation 0000-00-00 (Christophe Dunand)
Last sequence changes 2012-05-21 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-05-21 (Christophe Dunand)
Peroxidase information: CheGPx01_C5
Name CheGPx01_C5
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus heterostrophus    [TaxId: 5016 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CheGPx01_C5
start..stop
S start..stop
CheGPx01_C4 341 1.09e-122 1..168 1..168
COsaGPx01 335 1.75e-120 1..168 1..168
ClunGPx01 322 6.06e-115 1..166 1..166
PterGPx01 323 7.17e-114 1..168 101..268
Gene structure Fichier Exons


exon

Literature and cross-references CheGPx01_C5
DNA ref. JGI genome:   scaffold_10 (2957568..2956747)
Protein sequence: CheGPx01_C5
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   168
PWM (Da):   %s   18846.6  
PI (pH):   %s   8
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASATSFYEFKPKDKKGQPYDLSQLSNKVVLVVNTASKCGFTPQFEGLEKLYKDIKSKYPDDFEILGFPCNQFGGQDPGTNEEIQEFCQVNYGVSFPVLGKIVNGSTADPAFEWLKNEKP
GLMGLKRVKWNFEKFLIGRDGKVKGRWASTKKPEDLKAEIEKELSKK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 intron).
DNA
Send to BLAST
CDS
Send to BLAST