Entry information : EglPrxII03
Entry ID 11064
Creation 2012-05-21 (Qiang Li)
Last sequence changes 2016-03-25 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-25 (Achraf Jemmat)
Peroxidase information: EglPrxII03
Name EglPrxII03
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue types Vascular tissue
Xylem
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrxII03
start..stop
S start..stop
EguPrxII03 330 3e-118 1..162 1..162
EgrPrxII03 330 3e-118 1..162 1..162
EcamPrxII03 330 3e-118 1..162 1..162
CsPrxII02 300 8e-107 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..155 155 N° 2 582..661 80 N° 3 1583..1836 254  
join(1..155,582..661,1583..1836)


exon

Literature and cross-references EglPrxII03
EST ref. GenBank:   JK644494.1
Protein sequence: EglPrxII03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17333.06  
PI (pH):   %s   5.64
Sequence 204
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDAIPDGTLAYFDEQDQLQQVSVHSLAAGKKAVLFAVPGAFTPTCSLKHVPGFIENAELLKSKGVDEILCLSVNDPFVMKAWAKTYPENKHVKFLADGSAKYTHALGLELDLSEKGLGTRSRRFALLVEDLKVKAANIESGGEFTVSGADEILKAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns) and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCCCGATCGCCGTCGGCGACGCCATCCCCGACGGCACCCTCGCCTACTTCGACGAGCAGGACCAGCTCCAGCAGGTCTCCGTGCACTCCCTCGCCGCCGGCAAGAAGGCCGTCCTCT
TCGCCGTCCCCGGCGCCTTCACCCCGACTTGCAG
GTGAGGGCCGCCGACTGCTTTTTTCTTTCTCGCCGTTCCCTCGTCCTGCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNGTGAATCGCAGCGTGAATCGTTGGGAATTCTTTGCCTAAATTGACGGTTTCATTTCTGTTTTCTAGAATGTTCTGTATTTCTTGAGTAGTGTGGAAGTGGTGTTCGATGC
GATTAGCTTCGTACGGTCGTCGCGAGGCTGTTAGATGTTTGTTTGGACCGAAACGAGTCATGATTCGTAAGCACCTGAATTCGTTTGGAAAATAGTGCATTATGCTACGGCCTGCTCGAT
TAAAGATGAGGTTTTTGGAGTGAATAACGCTGGAATTGTCACTAGCGATTGTAGCTTCGATCTTGCGGTATAACCGTTGTTTGTATCGTTCGATTTGCAGTCTGAAGCACGTGCCGGGCT
TCATTGAGAACGCCGAGCTGCTGAAATCCAAGGGTGTGGATGAGATTCTGTGTCTCAGCG
GTATATTCTTTATCTTTTTCCGTCTCTGTGCGATTTCTTTCGTTCTTTTTTTTTTCAGAG
CCGATGCTTTGTTTTAAAGGTTACACCTAATGTTTCTGTCCTTACTATTGAGTAATGTAGTGTAGTGCATCTGCTCGTTAGTGACGAGGTAAAGAAGCTATCTTCAGTGAGTCGCCAAAT
ATAATGGTTTCAGCAAGCATCAAGAATCTTAAACTTATAATAACGGGGATTGGGGACTGTACTGGTTTTCTGGAGATTACAAGGAAATGCAAAAGGGACTCCAGTTTTGACTTTGAGCAG
TTGCTTGCCCAATTATTAGTTGGGAGTATTCACGAGTTGACTTTAAGCAGTTGTTACGAGGCATCAGTCAGTAGATAAATATATCATGTGTGATATTTTTCCTTGTTGCCGCTCTTCAAA
GCTTGGTAGTGTAGTTGGTGTAAGTCTAATTCCATCTAAAATTGTGCCTTGTGGTCAAGAACTCTCTCCCTCTCTGGGTGGGCCATGTGGTTTTACTTTTCAATCAAACTATTATGCTTA
TTAACCAAATGCTGGATTGCTAATGACACAGTGAGTTCAAGATCCTGCTTGGGAAACAACTACAGAAAGCTAGTCCAAAAAGAACTCGGTTTCTGGGTCCTAGGACACTTGAAAGAGCTT
GAATTGAAACTTTGCACCGTCATTAGTGAAAATATGGCTTTGCTTAACGCTCTCGTATCTAATTCCATATTTGATTCCAGAGTTGAGCTCCTAGATGTTGTATGGAGTCTATTAAAGAGT
TTGCACCATCCTTTAGTTAATAAAACGTGCTAGCTTTAGAACAGATGGCAGTTTGTCTGTCTTNNNNAATCCAGTCCTACCATGTGTTTTTTGTTTTTTTCCCCTGAATATCGTGATGCT
CATTTTGGTCCTATTTTTCAGTGAATGACCCATTTGTGATGAAGGCGTGGGCGAAGACTTACCCTGAGAACAAGCATGTAAAGTTCTTGGCAGATGGTTCGGCGAAATACACCCATGCTC
TTGGCCTCGAGCTTGACCTAAGTGAGAAGGGGCTTGGGACTCGCTCCAGGAGATTTGCTCTCTTGGTCGAGGATCTCAAGGTGAAGGCAGCCAACATCGAATCCGGGGGAGAGTTCACCG
TCTCCGGCGCTGATGAAATCCTTAAAGCTCTCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCCCGATCGCCGTCGGCGACGCCATCCCCGACGGCACCCTCGCCTACTTCGACGAGCAGGACCAGCTCCAGCAGGTCTCCGTGCACTCCCTCGCCGCCGGCAAGAAGGCCGTCCTCT
TCGCCGTCCCCGGCGCCTTCACCCCGACTTGCAG
TCTGAAGCACGTGCCGGGCTTCATTGAGAACGCCGAGCTGCTGAAATCCAAGGGTGTGGATGAGATTCTGTGTCTCAGCGTGAATG
ACCCATTTGTGATGAAGGCGTGGGCGAAGACTTACCCTGAGAACAAGCATGTAAAGTTCTTGGCAGATGGTTCGGCGAAATACACCCATGCTCTTGGCCTCGAGCTTGACCTAAGTGAGA
AGGGGCTTGGGACTCGCTCCAGGAGATTTGCTCTCTTGGTCGAGGATCTCAAGGTGAAGGCAGCCAACATCGAATCCGGGGGAGAGTTCACCGTCTCCGGCGCTGATGAAATCCTTAAAG
CTCTCTGA

Retrieve as FASTA