Entry information : EglPrxII02
Entry ID 11066
Creation 2012-05-21 (Qiang Li)
Last sequence changes 2016-04-04 (Christophe Dunand)
Sequence status partial
Reviewer Achraf Jemmat
Last annotation changes 2016-04-06 (Achraf Jemmat)
Peroxidase information: EglPrxII02
Name EglPrxII02
Class Atypical 2-Cysteine peroxiredoxin (type II)     [Orthogroup: PrxII002]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrxII02
start..stop
S start..stop
EgrPrxII02 338 1e-120 1..195 1..196
EcamPrxII02 338 2e-120 1..195 1..196
EguPrxII02 337 3e-120 1..195 1..196
CclPrxII05 299 1e-104 1..195 24..224
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..201 201 N° 2 308..337 30 N° 3 1717..1875 159 N° 4 2566..2660 95
N° 5 2835..2937 103  
join(1..201,308..337,1717..1875,2566..2660,2835..2937)


exon

Literature and cross-references EglPrxII02
Protein sequence: EglPrxII02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   195 (384)
PWM (Da):   %s   18523.56 (41904.9)  
PI (pH):   %s   8.19 (7.09) Peptide Signal:   %s   cut: 21 range:21-404
Sequence 236
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLLAKRSSSSVLxxxxxxxxxxxxxxxxxxxxSAAPGVSLQKARSWDEGVSSKFATTPLKDIFEGKKVVIFGLPGAYTGVCSQQHVPSYKNNIDKFKAKGIDSVICVAVNDPYTMNGWAENLKAKxxIEFYGDFDASFHKSLDLTKDLSAALLGLRSERWSAYVEDGKVKALNVEEAPSDLKVSGAEVILGQI

Retrieve as FASTA  
Remarks Partial sequence from NGS. Short fragment is missing due to NNNNN.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGTCGCTGCTCGCGAAGCGCTCGAGCTCCTCCGTCCTCGGCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCCGCGGCGCCGGGCG
TCTCCCTCCAGAAGGCTCGGAGCTGGGACGAGGGCGTGTCCTCCAAGTTCGCCACCACCCCTCTCAAGGATATCTTCGAG
GTTGGTCTTCGATTTCTTGCTGATTGCTTCATTCGCAGTG
GAAGTTCAGCTTCTGAATTTTTACTAATTTGCTTTGCCTGGGCTTCATTCGGACATGGGATTTCAGGGCAAGAAGGTGGTGATTTTCGGTCTCCCGGTGAGTGAACTCTCGGCTCTTTCA
TGTCTGTAGTTTCGTGGGAAATAATCGAGCCCTTTTTGTCTTTGGGCAGTTGATTCATGGGTGTCGATTGCAGCAAGCAATGTCTTCCTTATTTAGTGCTAACTTAGCGGCAAAGATTGC
TCTTTTTTTTCCGACATCTGAAATGGTTGAATAAGACAGAGGAGATGCGTCTGAATTGTCTAATGGGAATCGTTTCAATTATTCGTTTAATGGGTTGCTTTCATGTTCTCGCCTTATTGG
TTGGTGTCATCGTGTGGAGGCTTGAATAGATCGATAGATTATGATATGCGCTAGACTTTGCCAATTGCCATGAGAGAGTCGTGTTATGCTCTTTGATAGCAAAAATAGAAATCTTTCCTT
TNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATGTTTGACGCTTCTATGAAGTATTGTC
CCATTCTTCGAACATTTATTGTACTTGTGAAAAGGATAGGTGCTGGGTTCCTAGCGGAAACTTCAAAGGCACTGCAGTCCATAATATGAGATTGCATGCTAGTCCACCATGTTTAGGTTC
TGTGGTTCACTTACTTCATGATCCTAGCTGCATCATTGACGAAAATTTGGACATAGAGGTGACTATTTAACCAACTTGTTATAACTTCCAACCAAAATGAAAGTAAAAAAGAAAAAACGA
TTTGGATTTAGACAATTTTAAATAAGTTTCACCNNNNNNNNNNNNNNNNNNNNNNGTACTTTTTTATATCGAGGTGTTCAATACTAGATAAAAGTCAATCTAAAACACTAAAAGCAAAAA
ATAGAAATAAGAAGTTGAAAAACATGTAACCTTGAACAAAACTTGCACAACAAAGTTAGTATGTTTAGAGAAAACTTTGTTGTTGTCTGTTAATAATGTAGTTTGATGTGATGCCATATT
TAATCTTCCATCTTACCTCTTAAAGCATTTCTAGTTTTATATACACCATATTTCTATTTTTTTAATTTGTACCCAAGTCCTTGATGCTGAATTCATCTTGCATCTAATGCCCAAGAGAGA
CTGCATATGTCAGTCTATGCAGTCTCTTCTCAATACCGTTGCATGTGTTTTCTCGGAATACATTATCCGGTTATAGTTCATGATGTGCATTATCTTGCCATTTTAACCTCGGAAACTGAG
ACATGTTAACTTTAAGAAGATTTGACATATTGAAGCTGTAGCTACTGCAGGTCAAATGATAAAGGATAGCAAGTTGATATTTAACAATTCTATACTGGNTTTCCTTCTTTCTCTTGGTGC
TTTCTATTCAAGTTTTCATATTTGATGTCTCCCAGGGTGCATACACTGGAGTTTGTTCACAGCAGCATGTGCCTAGCTACAAGAATAATATCGATAAGTTTAAGGCTAAAGGCATAGACT
CTGTGATTTGTGTGGCTGTCAATGACCCCTACACCATGAATGGCTGGGCTGAAAATCTCAAAGCAAAANNNNNN
GATGCTGTAAGTTACTAATTTTGAAACCCAATTCTTTGCTTCTAGA
GATGAACTACTGTGTCTGCCTTACATATTTTCTTCATCCAAATATCCTTTTGGCGTCTTTTCTCTCTTAAATGAATTATGAACGGTTTTGGAATGTTTGAGTTGGGTGTTGAGTTCCTTG
ACTCATCTTTTTGATAATTTCTTGAGGAAAAATTTGTTGATTGTTGTGAGGATTTCTGGTATTGCCTCACATTTCTTCCTGCAACTTGTAGAACATCAATGCGAGGTTACTTTCTTTTGT
TTTTATTTTCTTCAAGAGGATGACTCTCCTTTATGTCACAATGTTCCGTTTGCAAAACTGTAAATGCATGTTGTTAGGACATGCGGTGATCACAATCAGAGGTGAAATGGCAGTAGAGCA
GCTAGAATACTTACCTCAGTTTTATTATTAGCGCCATCTTTAAAGAAAGTGTACTACTACAGAAGTTTTCTTGGGCAAAACAATCCATTTCCAGAGATGCAAATGAGGCTTCTTTTTTTA
GAGTATGTGTGTGACACTGTGAAGGAATGTGGTTCATGTATGCACAACAAGCAAAGCTTGATTTTTACCTTGTTTGTGAACTTCTGTCATCTCTGCCTCCCCACATTTTAAAGTGAAAGA
AGGTTCTGACATGAGCTTGTGCTTGTTTTTCTTAATCATAACAGATCGAATTCTATGGGGATTTTGATGCTAGCTTCCATAAGAGCTTGGACTTGACTAAAGATCTCTCAGCAGCTTTGC
TTGGACTTCGCTCTGAAAG
GTATGCCCTAGGCCCTAATAAGTTAATATTGGACATCAAACACCTCCTTGAATCTCCTTCCGTCATTTTTACCTTTGGACCATCACTTTATGGATGAAATG
CCTAATTAAATGATCAGTTTGTCCTTGGATCTACTCTTTTTTTTTGGGTAATCAAATGGTTGCTCTGGTGTAGATGGTCAGCTTATGTGGAGGACGGGAAAGTGAAGGCTCTCAATGTGG
AAGAAGCTCCATCCGACCTCAAGGTTTCTGGTGCCGAGGTTATTCTGGGACAGATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGTCGCTGCTCGCGAAGCGCTCGAGCTCCTCCGTCCTCGGCGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTCCGCGGCGCCGGGCG
TCTCCCTCCAGAAGGCTCGGAGCTGGGACGAGGGCGTGTCCTCCAAGTTCGCCACCACCCCTCTCAAGGATATCTTCGAG
GGCAAGAAGGTGGTGATTTTCGGTCTCCCGGGTGCATACA
CTGGAGTTTGTTCACAGCAGCATGTGCCTAGCTACAAGAATAATATCGATAAGTTTAAGGCTAAAGGCATAGACTCTGTGATTTGTGTGGCTGTCAATGACCCCTACACCATGAATGGCT
GGGCTGAAAATCTCAAAGCAAAANNNNNN
ATCGAATTCTATGGGGATTTTGATGCTAGCTTCCATAAGAGCTTGGACTTGACTAAAGATCTCTCAGCAGCTTTGCTTGGACTTCGCTCTG
AAAG
ATGGTCAGCTTATGTGGAGGACGGGAAAGTGAAGGCTCTCAATGTGGAAGAAGCTCCATCCGACCTCAAGGTTTCTGGTGCCGAGGTTATTCTGGGACAGATA

Retrieve as FASTA