Entry information : BnaAPx-CcP
Entry ID 11106
Creation 2012-06-04 (Christophe Dunand)
Last sequence changes 2012-06-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-04 (Christophe Dunand)
Peroxidase information: BnaAPx-CcP
Name BnaAPx-CcP
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Bigelowiella
Organism Bigelowiella natans    [TaxId: 227086 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BnaAPx-CcP
start..stop
S start..stop
PparCcP01 283 1.53e-96 10..263 12..273
EgraAPx-CcP01 291 5.17e-95 9..260 130..382
EgraAPx-CcP01 286 3.54e-93 7..260 385..639
EUgAPx-CcP03 276 2.86e-94 16..260 1..245
EhuxAPx-CcP04 276 1.22e-93 10..260 1..253
Gene structure Fichier Exons


exon

Literature and cross-references BnaAPx-CcP
DNA ref. JGI genome:   scaffold_68 (87868..89076)
Cluster/Prediction ref. JGI gene:   42846
Protein sequence: BnaAPx-CcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   271 (428)
PWM (Da):   %s   29416.25 (45491.0) Transmb domain:   %s   o577-599i
PI (pH):   %s   4.56 (5.26) Peptide Signal:   %s   cut: 23 range:23-450
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFATATDLKLDWAGLKNDLATMIKAKECGPIMIRLSWHDAGTYCKADNSGGARGAQRFEEGESQHGANAGLDVAIGLLKDIQEKYPISAADLWAFASCVATEVMGGPKIAFRAGRDDIPD
PTGCVEEGRLPDADKGSDHLRSVFGRMGFSDKDIVVLSGAHTVGRCHGDRSGFEGAWTEAPLQWDNAYFKNIMSKSYAAETTAAGNPQYRNADADIIALETDLALTTDPEFKKYTEEFAN
DAEAFNKAYAETYQKLQELGWGSKGLTEIAW*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
CDS
Send to BLAST