Entry information : XparCcP
Entry ID 11125
Creation 2012-06-06 (Christophe Dunand)
Last sequence changes 2012-06-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-06 (Christophe Dunand)
Peroxidase information: XparCcP
Name XparCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Ascomycota Lecanoromycetes Teloschistaceae Xanthoria
Organism Xanthoria parietina    [TaxId: 107463 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value XparCcP
start..stop
S start..stop
CgrayCcP01 573 0 1..369 1..371
AderCcP02 527 0 1..372 1..375
XhevCcP01 522 0 1..372 1..369
MbicCcP02 513 0 1..372 1..373
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2986716..2987125 410 N° 2 2986539..2986660 122 N° 3 2986123..2986478 356 N° 4 2985825..2986055 231
complement(join(2985825..2986055,2986123..2986478,2986539..2986660,2986716..2987 125))


exon

Literature and cross-references XparCcP
DNA ref. JGI genome:   scaffold_1 (2987125..2985825)
Cluster/Prediction ref. JGI gene:   37801
Protein sequence: XparCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   373
PWM (Da):   %s   41198.36  
PI (pH):   %s   8.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSVARACTRVASSRTFTSPTAASSTTRRACARQTFQNSSRRGYASGPNSASSRTPYLIGALALAGAGGAYFYLNNGSLLQAKEGSAGETRGVFTPTKEDYQKVYNLIASRLEEKDDYDDGSYGPVIVRLAWHCSGTYDKLTNTGGSNGATMRFAPEGDHGANAGLKAARDFLDPVKQQFPWITYSDLWTLAGVCAIQEMQGPVIPWRPGRADRDVSMCTPDGRLPDGAKEQSHLRAIFGRMGFDDREIVALSGAHAIGRCHTDRSGFDGPWSFSPTVVTNDYYKLLLNEKWNFRKWDGPKQYQDLASKSLMMLPTDMALIQDKEFKKHVDRYAKDNDVFFQDFRDVLVKLLELGVPFQSKPEDRMELKPTS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTCCGTAGCTCGCGCCTGTACCCGCGTTGCCTCATCCAGGACCTTCACGTCCCCAACAGCAGCCTCCTCGACCACTCGTCGCGCTTGTGCACGCCAGACCTTCCAAAATTCCTCA
CGCCGAGGTTACGCTTCCGGTCCGAACAGTGCCTCTTCCAGAACTCCCTATCTCATCGGCGCCCTTGCGCTCGCCGGTGCCGGCGGAGCTTACTTTTATCTTAACAATGGATCCTTGTTG
CAGGCCAAAGAAGGAAGCGCCGGGGAGACCCGTGGCGTCTTCACTCCTACCAAAGAAGACTACCAGAAGGTCTACAATCTCATCGCTTCCCGTTTGGAAGAGAAGGATGATTATGATGAC
GGAAGCTACGGTCCCGTTATTGTCCGATTAGCCTGGCATTGTAGCGGAAC
GTAAGTCGGACAGCTTTAGATATGCAAGCGGACATCGACGCTAATTGCCTCACAGTTACGACAAGTTGAC
GAATACCGGAGGTTCCAACGGCGCCACCATGCGATTCGCCCCCGAAGGAGACCACGGCGCCAATGCTGGGTTGAAAGCAGCCCGTGATTTCCTCGACCCTGTCAAAC
GTGAGTAGTCGCA
AGAAACCTCTCAGCAACATGTGCCGGCGGTTGACAATACTGGGGTAGAACAATTCCCATGGATAACCTATTCGGACCTGTGGACACTAGCAGGCGTTTGTGCGATCCAAGAGATGCAGGG
GCCCGTGATCCCCTGGCGACCCGGCCGAGCCGACCGAGACGTCTCCATGTGCACGCCGGACGGACGTCTCCCGGACGGCGCCAAAGAACAATCACATCTGCGCGCCATCTTCGGTCGCAT
GGGTTTCGACGACCGTGAGATCGTGGCGCTCAGCGGCGCACATGCTATCGGTCGATGCCACACCGATCGAAGTGGATTCGACGGGCCATGGAGCTTCAGTCCCACCGTCGTCACAAACGA
CTACTACAAACTTCTGTTGAACGAGAAATGGAATTTCCGAAAG
GTGTGTTGAAATTCGCCCGATCCGATCCGAACCGAACATGGGCCATACTAACACCTCAACCCCACAGTGGGACGGCC
CCAAACAATACCAAGACCTGGCCAGCAAATCCCTCATGATGCTCCCGACCGACATGGCCCTCATCCAGGACAAGGAATTCAAAAAGCACGTCGACCGCTACGCCAAGGACAACGATGTCT
TCTTCCAAGATTTCCGCGACGTCCTGGTCAAGCTCCTGGAACTCGGGGTCCCCTTCCAAAGCAAGCCGGAAGACCGGATGGAGCTGAAGCCGACCAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCTCCGTAGCTCGCGCCTGTACCCGCGTTGCCTCATCCAGGACCTTCACGTCCCCAACAGCAGCCTCCTCGACCACTCGTCGCGCTTGTGCACGCCAGACCTTCCAAAATTCCTCA
CGCCGAGGTTACGCTTCCGGTCCGAACAGTGCCTCTTCCAGAACTCCCTATCTCATCGGCGCCCTTGCGCTCGCCGGTGCCGGCGGAGCTTACTTTTATCTTAACAATGGATCCTTGTTG
CAGGCCAAAGAAGGAAGCGCCGGGGAGACCCGTGGCGTCTTCACTCCTACCAAAGAAGACTACCAGAAGGTCTACAATCTCATCGCTTCCCGTTTGGAAGAGAAGGATGATTATGATGAC
GGAAGCTACGGTCCCGTTATTGTCCGATTAGCCTGGCATTGTAGCGGAAC
TTACGACAAGTTGACGAATACCGGAGGTTCCAACGGCGCCACCATGCGATTCGCCCCCGAAGGAGACCAC
GGCGCCAATGCTGGGTTGAAAGCAGCCCGTGATTTCCTCGACCCTGTCAAAC
AACAATTCCCATGGATAACCTATTCGGACCTGTGGACACTAGCAGGCGTTTGTGCGATCCAAGAGATG
CAGGGGCCCGTGATCCCCTGGCGACCCGGCCGAGCCGACCGAGACGTCTCCATGTGCACGCCGGACGGACGTCTCCCGGACGGCGCCAAAGAACAATCACATCTGCGCGCCATCTTCGGT
CGCATGGGTTTCGACGACCGTGAGATCGTGGCGCTCAGCGGCGCACATGCTATCGGTCGATGCCACACCGATCGAAGTGGATTCGACGGGCCATGGAGCTTCAGTCCCACCGTCGTCACA
AACGACTACTACAAACTTCTGTTGAACGAGAAATGGAATTTCCGAAAG
TGGGACGGCCCCAAACAATACCAAGACCTGGCCAGCAAATCCCTCATGATGCTCCCGACCGACATGGCCCTC
ATCCAGGACAAGGAATTCAAAAAGCACGTCGACCGCTACGCCAAGGACAACGATGTCTTCTTCCAAGATTTCCGCGACGTCCTGGTCAAGCTCCTGGAACTCGGGGTCCCCTTCCAAAGC
AAGCCGGAAGACCGGATGGAGCTGAAGCCGACCAGCTAA

Retrieve as FASTA