Entry information : MbrCcP
Entry ID 11127
Creation 2012-06-06 (Christophe Dunand)
Last sequence changes 2012-06-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-06-07 (Christophe Dunand)
Peroxidase information: MbrCcP
Name MbrCcP
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Codonosigidae Monosiga
Organism Monosiga brevicollis    [TaxId: 81824 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MbrCcP
start..stop
S start..stop
SAspCcP 390 7.75e-138 1..266 63..322
SAcoCcP01 321 4.18e-111 9..266 6..264
GprCcP03 318 1.64e-110 10..267 5..266
MlpCcP02 322 1.67e-110 7..267 97..360
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11127' 'complement(join(1..268,380..435,577..705,803..1153))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 803..1153 349 N° 2 577..705 127 N° 3 380..435 54 N° 4 1..268 266
complement(join(1..268,380..435,577..705,803..1153))


exon

Literature and cross-references MbrCcP
Protein ref. JGI genome:   scaffold_6 (1434357..1433205)
DNA ref. GenBank:   NW_001865043.1 (1434357..1433205)
EST ref. GenBank:   FE867266.1
Cluster/Prediction ref. JGI gene:   16194
Protein sequence: MbrCcP
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   267 (429)
PWM (Da):   %s   29582.31 (46426.4)  
PI (pH):   %s   4.77 (9.39) Peptide Signal:   %s   cut: 33 range:33-461
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSWFAASVDWQSVRADIEEAIDNNDIDGQAPGPLLLRLAWHCSGTYDKETGTGGSNGATMRFALESDDPANAGLQKARNLLEPIKAKYPGMTFADLYTFAGKVAVESMGGPEIAWKPGRS
DAADETFCPPNGRLPDATQGAAHIRQVFYRMGFNDQEIVALVGAHTVGHCHKDRSGFDGPWSFGPYSFDNDFFRLLFDETWTVRPNFKPTQYEDSTGKLMMLPTDLAIVQDPKFRQWARK
YADDMDLFHRDFAAAFAKLMDLGVPRR

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and ESTs
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTGGTTTGCTGCCAGTGTGGACTGGCAGAGCGTTCGTGCCGACATTGAGGAAGCCATTGATAACAACGACATCGATGGCCAGGCCCCCGGCCCCCTCCTCCTCCGCCTCGCGTGG
CATTGCTCTGGCACCTACGACAAGGAGACGGGCACCGGTGGCAGCAACGGCGCGACCATGCGCTTTGCGCTCGAGTCGGATGATCCCGCCAACGCCGGCCTTCAAAAGGCGCGCAACCTC
CTTGAGCCCATCAAGGCCAAGTATCCCGGTTCGCATCCGTCGTCTTGCCGCGCATATCTCGCCTTTCCCCGTTTTTTTTTTGTTTTTTTTTTCAGCGAAATCTGTCTCATG
GCCCCATGG
ATTGCCCCGTACCTTGCAGGCATGACTTTTGCCGATCTCTACACCTTTGCCGGCAAGGTGGCCGTCGAGTCGATGGTAAGCCCTGTCCATATCCCGTAATGATGGCGACAGTGATGTTGT
TGCCGTCGCCGGCGCTGTTCCCTTTCTTGATGTCCCCAGCCTCGTCTTCTTCGTCGCATGTTACAATCTCACCCTTGCCTTGACGTTCCCTTCACCAGG
GTGGTCCCGAGATTGCCTGGA
AGCCGGGCCGCTCGGATGCCGCTGATGAGACCTTCTGCCCTCCCAACGGCCGCCTGCCCGATGCCACCCAGGGTGCTGCCCACATCCGCCAGGTCTTCTACCGCATGGTACGTAACAAAC
CACATGACCTCACGTTGAGTCGTTGCACCGCTGAGGCTTGCAGCAGTCTGATGAGACAAACAAACACCCCCAAAAAATTGCCATAGGGCTTCAACGATCAGGAAATTGTTGCGTTGGTGG
GGGCCCACACCGTGGGCCACTGCCACAAGGACCGCTCCGGCTTTGATGGACACCTTGGTCCTTTGGCCCCTACAGCTTCGACAACGACTTTTTCCGCCTGCTCTTTGACGAGACCTGGAC
CGTGCGCCCCAACTTCAAGCCCACTCAGTACGAGGACTCGACCGGCAAGCTAATGATGCTGCCCACCGATCTGGCCATTGTCCAGGATCCCAAGTTCCGCCAGTGGGCTCGCAAGTACGC
TGACGACATGGACCTTTTCCACCGTGACTTTGCCGCCGCTTTTGCCAAGCTAATGGACCTCGGCGTGCCGCGTCGTTAA

Retrieve as FASTA