Entry information : PindGPx01
Entry ID 11194
Creation 2012-07-13 (Christophe Dunand)
Last sequence changes 2012-07-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-07-13 (Christophe Dunand)
Peroxidase information: PindGPx01
Name PindGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Sebacinaceae Piriformospora
Organism Piriformospora indica    [TaxId: 65672 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PindGPx01
start..stop
S start..stop
SverGPx01 304 1.83e-107 1..181 1..185
XbadGPx01 278 1.62e-97 2..164 6..167
PmicGPx01 273 2.15e-94 3..162 71..229
PtinGPx01 272 3.5e-94 3..161 67..224
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11194' 'join(2597..2620,2672..2757,2841..3059,3113..3158,3206..3376)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2597..2620 22 N° 2 2672..2757 84 N° 3 2841..3059 217 N° 4 3113..3158 44
N° 5 3206..3376 169  
join(2597..2620,2672..2757,2841..3059,3113..3158,3206..3376)


exon

Literature and cross-references PindGPx01
DNA ref. GenBank:   CAFZ01000405.1 (2597..3376)
Protein sequence: PindGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   181 (230)
PWM (Da):   %s   20002.07 (25116.8)  
PI (pH):   %s   6.27 (8.04) Peptide Signal:   %s   cut: 27 range:27-256
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTFYDLKAELPGKPEPYTFDQLKGKVVLIVNTASQCGFTPQYKGLETLYEKYKDRGFVILGFPSNQFGGQEPGTDEDIATFCELNHGVTFPLMKKSDVNGDNTNEVYQWLKKEKSGLLGMSRIWNFEKFLIDQNGKVVHRWASTTTP
SSIEPHVEKLLAQTPTATTTAEPAAPAATTSS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCACTTTTTACGATCTCAAGAGGTTGGTTTTAACCTGCGACTGGAATGACGTTGATATTCACCCTATTTCCAGGCAGAGCTCCCGGGTAAGCCGGAGCCCTATACGTTTGACCAGC
TCAAGGGCAAGGTTGTCCTCATTGTCAACACGGCCTCTCAATG
TGGTATGTATACTTACTCGTCGTAGGAATTTACTCACATTTTTCCCCCTCTTCTCCGATACCACCCACGTCATCTCC
GACTGCAGCGGGTTTACACCGCAATACAAGGGTCTCGAGACGCTCTATGAAAAGTACAAGGACCGTGGATTCGTCATTCTTGGATTCCCATCGAATCAATTTGGCGGACAAGAGCCCGGA
ACGGATGAGGATATTGCCACTTTTTGCGAGCTCAACCATGGAGTCACGTTTCCATTGATGAAGAAGAGTGACGTGAATGGAGATAACACCAACGAGGTTTACCAATG
TGGTATGTCTATC
TCCCATCCAGCAAGGCCGTATACTAATGGGACGGCTGGGCAGGTTGAAAAAGGAAAAATCTGGACTGCTTGGAATGTCCCGAATCAAGAGGTAAGGATATTCATACATCTATATCCGATA
TATGCTGACGCGAGTAGTGGAACTTTGAGAAATTCCTGATCGACCAAAACGGCAAAGTAGTCCACCGATGGGCTTCGACGACGACTCCAAGCTCCATTGAGCCACATGTTGAGAAACTGC
TGGCGCAGACTCCAACGGCGACGACGACCGCAGAGCCCGCGGCTCCAGCTGCCACTACCTCGTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACCACTTTTTACGATCTCAAGGCAGAGCTCCCGGGTAAGCCGGAGCCCTATACGTTTGACCAGCTCAAGGGCAAGGTTGTCCTCATTGTCAACACGGCCTCTCAATGCGGGTTTACA
CCGCAATACAAGGGTCTCGAGACGCTCTATGAAAAGTACAAGGACCGTGGATTCGTCATTCTTGGATTCCCATCGAATCAATTTGGCGGACAAGAGCCCGGAACGGATGAGGATATTGCC
ACTTTTTGCGAGCTCAACCATGGAGTCACGTTTCCATTGATGAAGAAGAGTGACGTGAATGGAGATAACACCAACGAGGTTTACCAATG
GTTGAAAAAGGAAAAATCTGGACTGCTTGGA
ATGTCCCGAATCAAG
TGGAACTTTGAGAAATTCCTGATCGACCAAAACGGCAAAGTAGTCCACCGATGGGCTTCGACGACGACTCCAAGCTCCATTGAGCCACATGTTGAGAAACTGCTG
GCGCAGACTCCAACGGCGACGACGACCGCAGAGCCCGCGGCTCCAGCTGCCACTACCTCGTCATGA

Retrieve as FASTA