1. Browse the Database
  2. View Redoxidase
Entry information : PterGPx01
Entry ID 11203
Creation 2012-07-18 (Christophe Dunand)
Last sequence changes 2012-07-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: PterGPx01
Name PterGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Pyrenophora
Organism Pyrenophora teres    [TaxId: 53485 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PterGPx01
start..stop		 S start..stop
PtritGPx01 515 0 1..268 1..271
AalteGPx01 336 1.01e-117 13..269 1..240
SturGPx01 331 7.9e-117 101..269 1..169
ClunGPx01 327 2.69e-115 101..265 1..165
Gene structure Fichier Exons►


exon

Literature and cross-references PterGPx01
DNA ref. JGI genome:   193709 (18522..19497)
Cluster/Prediction ref. JGI gene:   9694
Protein sequence: PterGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   268 (186)
PWM (Da):   %s   29511.28 (19580.5)  
PI (pH):   %s   10.23 (5.10) Peptide Signal:   %s   cut: 28 range:28-213
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMVLGRNSGVSHVVNGGGARGTAPQRVTRAGASVLKLRDSFTTTIAAASAYHTTGYTASTLRTLHREGLFGRTRIHIQEGFRDQKALSRAFSFTTSKKPAMASATNFYEFKPKDKKGAVY
DLSKLNGKVVLVVNTASKCGFTPQFEGLEKLYKEIKAAHPNDFEILGFPCNQFGGQDPGSNEEIQEFCQLNYGVSFPVLGKIDVNGATADPAFEWLKNEKPGLMGLKRVKWNFEKFLVGR
DGKVKGRWASTKKPEDLKAEIEKELNNK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST