Entry information : RrufCcP01
Entry ID 11206
Creation 2012-07-18 (Christophe Dunand)
Last sequence changes 2012-07-18 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: RrufCcP01
Name RrufCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP002]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Patellariaceae Rhytidhysteron
Organism Rhytidhysteron rufulum    [TaxId: 37885 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value RrufCcP01
start..stop
S start..stop
HpulCcP 545 0 1..318 1..318
GsteCcP01 541 0 1..318 1..318
ApruCcP02 526 0 1..318 1..318
BdotCcP02 519 0 2..318 3..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9550..9659 110 N° 2 8623..9469 847  
complement(join(8623..9469,9550..9659))


exon

Literature and cross-references RrufCcP01
DNA ref. JGI genome:   NODE_47_length_33809_cov_42.821762 (9659..8623)
Cluster/Prediction ref. JGI gene:   8154
Protein sequence: RrufCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318
PWM (Da):   %s   35241.5  
PI (pH):   %s   5.65
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKPGDYDAVRKSVLELLKQPEYDDGSAGPVLVRLAWHSAGTYDLTTDTGGSNGAGMRYESEGGDPANAGLQHARVFLEPVKTSHPWITYSDLWTLAGCSAIEAMGGPSILWLPGRTDYVDDSKLPPRGRLPDGAKGADHIRHIFYRMGFTDQEIVALSGAHNLGRCHSDRSGFEGKWVHSPTRFSNQYFRLLMRLQWKPKTLSNGTKQFSYVDDDLEEELMMLPTDMALLEDEGFKVWVKRYAEDKDVFFADFARAFAKLMELGIVRDEKGAVLNTDNVKGGYVSAPKKPDVPGVPNLSNEEAEPSRKENAQFKARL

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAAACCAGGTGATTACGATGCCGTCCGTAAGTCCGTTCTTGAGCTGCTCAAACAGCCAGAATATGACGACGGCAGCGCGGGTCCTGTTCTCGTCCGTCTAGCATGGTACGTCCCC
AATTCACCAACTCCCCAACTCTCCAACCCCACACCACCATAAACCCTCAATCTAACACGCAATACACCAGGCATTCAGCCGGAACCTACGACCTCACAACCGACACCGGCGGCTCCAACG
GCGCAGGAATGCGTTACGAATCCGAAGGCGGGGACCCCGCAAACGCCGGGCTCCAACACGCACGCGTCTTCCTCGAGCCCGTAAAAACCTCGCACCCATGGATAACATACTCAGACCTGT
GGACACTAGCCGGTTGCTCCGCTATAGAAGCCATGGGGGGTCCTTCGATCCTCTGGCTCCCAGGTCGAACCGACTACGTCGACGATAGCAAGTTACCACCTCGAGGCCGACTCCCCGATG
GCGCGAAGGGCGCTGATCATATCCGGCATATATTCTACCGAATGGGGTTTACGGATCAAGAGATTGTGGCGTTGAGTGGGGCGCATAATCTAGGGAGATGTCATAGCGATAGGAGTGGGT
TTGAGGGGAAATGGGTTCATAGTCCCACGAGGTTTAGTAACCAGTATTTCCGCCTTCTTATGCGATTACAATGGAAGCCTAAAACTCTCTCCAACGGCACCAAGCAATTCTCCTACGTTG
ATGACGATCTAGAGGAGGAACTCATGATGCTACCGACTGATATGGCACTTCTTGAAGACGAGGGTTTCAAGGTTTGGGTTAAGAGATACGCGGAAGATAAAGATGTGTTCTTTGCGGATT
TCGCGAGGGCGTTTGCGAAGTTGATGGAGTTGGGGATTGTGAGGGATGAGAAGGGAGCGGTGCTGAATACGGATAATGTAAAAGGGGGATATGTTTCTGCGCCTAAGAAACCGGATGTCC
CTGGTGTGCCGAATCTATCGAATGAAGAGGCGGAACCATCAAGAAAGGAAAACGCCCAATTCAAGGCAAGGTTATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGTAAACCAGGTGATTACGATGCCGTCCGTAAGTCCGTTCTTGAGCTGCTCAAACAGCCAGAATATGACGACGGCAGCGCGGGTCCTGTTCTCGTCCGTCTAGCATGGCATTCAGCC
GGAACCTACGACCTCACAACCGACACCGGCGGCTCCAACGGCGCAGGAATGCGTTACGAATCCGAAGGCGGGGACCCCGCAAACGCCGGGCTCCAACACGCACGCGTCTTCCTCGAGCCC
GTAAAAACCTCGCACCCATGGATAACATACTCAGACCTGTGGACACTAGCCGGTTGCTCCGCTATAGAAGCCATGGGGGGTCCTTCGATCCTCTGGCTCCCAGGTCGAACCGACTACGTC
GACGATAGCAAGTTACCACCTCGAGGCCGACTCCCCGATGGCGCGAAGGGCGCTGATCATATCCGGCATATATTCTACCGAATGGGGTTTACGGATCAAGAGATTGTGGCGTTGAGTGGG
GCGCATAATCTAGGGAGATGTCATAGCGATAGGAGTGGGTTTGAGGGGAAATGGGTTCATAGTCCCACGAGGTTTAGTAACCAGTATTTCCGCCTTCTTATGCGATTACAATGGAAGCCT
AAAACTCTCTCCAACGGCACCAAGCAATTCTCCTACGTTGATGACGATCTAGAGGAGGAACTCATGATGCTACCGACTGATATGGCACTTCTTGAAGACGAGGGTTTCAAGGTTTGGGTT
AAGAGATACGCGGAAGATAAAGATGTGTTCTTTGCGGATTTCGCGAGGGCGTTTGCGAAGTTGATGGAGTTGGGGATTGTGAGGGATGAGAAGGGAGCGGTGCTGAATACGGATAATGTA
AAAGGGGGATATGTTTCTGCGCCTAAGAAACCGGATGTCCCTGGTGTGCCGAATCTATCGAATGAAGAGGCGGAACCATCAAGAAAGGAAAACGCCCAATTCAAGGCAAGGTTATGA

Retrieve as FASTA