Entry information : SAcoHalPrx01
Entry ID 11213
Creation 2012-07-19 (Christophe Dunand)
Last sequence changes 2014-11-26 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-11-05 (Achraf Jemmat)
Peroxidase information: SAcoHalPrx01
Name SAcoHalPrx01
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Ascomycota Saitoella
Organism Saitoella complicata    [TaxId: 5606 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SAcoHalPrx01
start..stop
S start..stop
SAcoHalPrx02 241 2e-79 1..237 22..250
PplHalPrx05 118 2e-32 1..237 11..238
SlutHalPrx03 106 4e-28 21..237 1..218
PinvHalPrx03 106 6e-28 45..237 37..224
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1417805..1418004 200 N° 2 1418071..1418581 511  
join(1417805..1418004,1418071..1418581)


exon

Literature and cross-references SAcoHalPrx01
DNA ref. JGI genome:   scaffold_1 (1417805..1418581)
Cluster/Prediction ref. JGI gene:   41642 [3' end]
Protein sequence: SAcoHalPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   237
PWM (Da):   %s   26759.46  
PI (pH):   %s   7.22
Sequence 278
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VQRLIWAFTLFTNIIWWAPTMIKARYTYTPKPLGQLKLAERYYRAPAPGDMRTPCPGLNTLANHGIIHRNGKKINPIDLFHALRDYYSADFFTCFSLLSGALQVGLSDDGYTLDLGRIGLHNFIEHDASISRPDSGWGKQECPDMELVKKFCEFGRGEGEGMIGVKEIARFRVMRERECQRHNPQYELSGLHPFITRGEPALILDVFGDGYGTDIHVSTTIIETWMGKETFPAGYVP

Retrieve as FASTA  
Remarks Partial sequence from genomic (no intron). Incorrect prediction from JGI (23 first AA are missing in the prediction)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCAGCGCCTTATCTGGGCGTTCACGCTCTTCACGAACATCATCTGGTGGGCACCGACTATGATCAAGGCTCGGTACACGTATACTCCCAAACCTTTGGGCCAACTCAAGCTTGCTGAGA
GGTATTATCGCGCTCCCGCACCGGGAGACATGAGGACTCCCTGTCCCGGGTTAAACACGTTGGCGAACCATGGGATCAT
GTAGGTTTTGCTGAACCTTTGGCCTCAGAAAGAGGAACATT
GACCTGAGGACTTCGATTTATATAGCCACCGTAACGGCAAGAAGATCAACCCGATCGACCTCTTCCACGCCCTCCGCGACTACTATTCCGCGGACTTCTTCACCTGCTTCTCCCTCCTCT
CCGGTGCTCTCCAAGTCGGTCTCTCCGATGACGGGTACACCCTCGACCTTGGCCGAATCGGCCTCCACAACTTCATCGAACACGATGCTTCGATTTCGCGCCCAGATTCCGGATGGGGAA
AGCAGGAGTGTCCGGATATGGAATTAGTGAAGAAGTTCTGTGAGTTTGGCCGTGGTGAGGGGGAGGGTATGATTGGGGTGAAGGAAATTGCGAGGTTTAGGGTGATGAGGGAGAGGGAGT
GTCAAAGGCATAATCCCCAGTACGAGCTTTCTGGTCTTCACCCGTTCATCACGCGTGGTGAGCCGGCGCTCATCCTTGACGTTTTTGGTGATGGGTATGGGACGGATATCCATGTCTCCA
CTACGATCATCGAGACTTGGATGGGGAAGGAGACTTTCCCTGCTGGGTATGTTCCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCAGCGCCTTATCTGGGCGTTCACGCTCTTCACGAACATCATCTGGTGGGCACCGACTATGATCAAGGCTCGGTACACGTATACTCCCAAACCTTTGGGCCAACTCAAGCTTGCTGAGA
GGTATTATCGCGCTCCCGCACCGGGAGACATGAGGACTCCCTGTCCCGGGTTAAACACGTTGGCGAACCATGGGATCAT
CCACCGTAACGGCAAGAAGATCAACCCGATCGACCTCTTCC
ACGCCCTCCGCGACTACTATTCCGCGGACTTCTTCACCTGCTTCTCCCTCCTCTCCGGTGCTCTCCAAGTCGGTCTCTCCGATGACGGGTACACCCTCGACCTTGGCCGAATCGGCCTCC
ACAACTTCATCGAACACGATGCTTCGATTTCGCGCCCAGATTCCGGATGGGGAAAGCAGGAGTGTCCGGATATGGAATTAGTGAAGAAGTTCTGTGAGTTTGGCCGTGGTGAGGGGGAGG
GTATGATTGGGGTGAAGGAAATTGCGAGGTTTAGGGTGATGAGGGAGAGGGAGTGTCAAAGGCATAATCCCCAGTACGAGCTTTCTGGTCTTCACCCGTTCATCACGCGTGGTGAGCCGG
CGCTCATCCTTGACGTTTTTGGTGATGGGTATGGGACGGATATCCATGTCTCCACTACGATCATCGAGACTTGGATGGGGAAGGAGACTTTCCCTGCTGGGTATGTTCCG

Retrieve as FASTA