1. Browse the Database
  2. View Redoxidase
Entry information : OsPrx122 (LOC_Os09g29490)
Entry ID 1132
Creation 2005-07-19 (Filippo Passardi)
Last sequence changes 2005-07-19 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-04-10 (Christophe Dunand)
Peroxidase information: OsPrx122 (LOC_Os09g29490)
Name (synonym) OsPrx122 (LOC_Os09g29490)
Class Class III peroxidase    [Orthogroup: Prx020]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Leaves
Pannicles
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx122
start..stop		 S start..stop
BdiPrx122 556 0 31..348 140..456
TmPrx07 555 0 34..349 22..336
TaPrx15-1A 554 0 34..349 22..336
TaPrx15-1D 553 0 34..349 22..336
Gene structure Fichier Exons►


exon

Literature and cross-references OsPrx122 (LOC_Os09g29490)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q6K4J4
DNA ref. GenBank:   NC_008402.1 (17881015..17878274)
Protein sequence: OsPrx122 (LOC_Os09g29490)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360 (325)
PWM (Da):   %s   38382.18 (35075.3) Transmb domain:   %s   o10-32i
PI (pH):   %s   4.9 (4.80) Peptide Signal:   %s   cut: 36 range:36-360
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALLLLRRGGGFAAATVLAVVVVALVLSCGGGAEAAVRDLRVGYY
AETCPDAEAVVRDTMARARAHEARSVASVMRLQFHDCFVNGCDGSVLMDATPTMAGEKEALSNINSLRSFDVVDEIKEALEERCPGVVSCADIIVMAARDAVALTGGPFWDVRLGREDSLTASQEDSDNIMPSPRANATTLIKLFAGYNLTVTDLVALSG
SHSIGEARCFSIVFRLYNQSGSGRPDPNMDPAYRAGLDSLCPRGGDENVTGGMDATPLVFDNQYFKDLVRLRGFLNSDQTLFSDNAGTRLAVRKFGEDQGAFFRAFVEGMIKMGELQNPR
KGEIRRNCRVANAPAPPPVEAEVAATSKAVVLVDF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 9, introns 1 and 2) and 8 ESTs.
Rice blast fungus interaction, leaf library induced by M.grisea
Promoter►
Send to BLAST
Send to cis Analysis
DNA ►
Send to BLAST
CDS►
Send to BLAST