Entry information : HpinGPx01
Entry ID 11334
Creation 2012-09-24 (Gisèle Passaia )
Last sequence changes 2012-09-24 (Gisèle Passaia )
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-10-03 (Christophe Dunand)
Peroxidase information: HpinGPx01
Name HpinGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hydnomerulius
Organism Hydnomerulius pinastri    [TaxId: 388859 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HpinGPx01
start..stop
S start..stop
PrubGPx01 320 2e-113 1..166 56..221
GliviGPx01 317 3e-113 1..166 1..166
PadelGPx01 317 5e-113 1..166 1..166
PinvGPx 305 8e-108 1..164 59..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 886243..886358 116 N° 2 886420..886442 23 N° 3 886501..886568 68 N° 4 886623..886796 174
N° 5 886859..886978 120  
join(886243..886358,886420..886442,886501..886568,886623..886796,886859..886978)


exon

Literature and cross-references HpinGPx01
Protein sequence: HpinGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166 (400)
PWM (Da):   %s   18529.17 (42859.9)  
PI (pH):   %s   7.18 (4.70) Peptide Signal:   %s   cut: 19 range:19-418
Sequence 208
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSTTSFYDLKTDLPNGTTYDFDQLKGKVVLIVNVASQCGFTPQYKGLQALYDKYKERGFVILGFPCNQFGGQEPGDDATIASFCERNHGVTFPLMKKSDVNGDNTNSVYQYLKNEKAGIMGLTRIKWNFEKFLIDQEGKVVNRWASTTTPQAIDAAVEKFYAGSQ*

Retrieve as FASTA  
Remarks Complete sequence from geomic (4 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCTTCAACTACCAGCTTCTATGACCTCAAGACCGATCTTCCCAACGGCACAACATACGACTTTGACCAACTGAAAGGGAAGGTGGTGCTCATCGTCAACGTCGCGTCGCAATGGTGCG
TGAAGTGCTGTGGTCGCAGAACGGCCCGAGATTTACTTAACTTCTTGGAACGTCAGCGGATTCACCCCTCAGTACAAGGGTAGGGCGAATCACCCATTCGTCGGTCACTTGATACTGAGT
GATTCGCTGATCTACAGGTCTCCAAGCCTTGTATGACAAGTACAAAGAGCGCGGATTTGTGATTCTCGGATTTCCATGCAACCAGGTGAGCAAGTGCGCCAACGGCAATTTCTGCATGGA
TTAACTGTTACGTTTCTAGTTTGGTGGACAAGAACCGGGTGATGACGCTACCATCGCCTCATTTTGCGAGCGCAACCACGGAGTCACCTTCCCTCTTATGAAGAAATCAGATGTGAACGG
AGACAACACCAACTCTGTTTATCAATACCTGAAGAACGAGAAAGCGGGAATTATGGGACTGACTCGGATCAAG
GTTCGTGCATGGATATGCACTATCTTTGACCCCTTTGGAGTTTGATG
CGTTTTTGTTTCCAGTGGAACTTTGAGAAGTTTTTGATTGATCAGGAGGGCAAGGTCGTGAATCGCTGGGCCTCGACTACCACTCCTCAGGCCATCGACGCTGCTGTGGAGAAGTTCTAT
GCTGGTTCCCAATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCTTCAACTACCAGCTTCTATGACCTCAAGACCGATCTTCCCAACGGCACAACATACGACTTTGACCAACTGAAAGGGAAGGTGGTGCTCATCGTCAACGTCGCGTCGCAATGCGGAT
TCACCCCTCAGTACAAGG
GTCTCCAAGCCTTGTATGACAAGTACAAAGAGCGCGGATTTGTGATTCTCGGATTTCCATGCAACCAGTTTGGTGGACAAGAACCGGGTGATGACGCTACCA
TCGCCTCATTTTGCGAGCGCAACCACGGAGTCACCTTCCCTCTTATGAAGAAATCAGATGTGAACGGAGACAACACCAACTCTGTTTATCAATACCTGAAGAACGAGAAAGCGGGAATTA
TGGGACTGACTCGGATCAAG
TGGAACTTTGAGAAGTTTTTGATTGATCAGGAGGGCAAGGTCGTGAATCGCTGGGCCTCGACTACCACTCCTCAGGCCATCGACGCTGCTGTGGAGAAGT
TCTATGCTGGTTCCCAATGA

Retrieve as FASTA