1. Browse the Database
  2. View Redoxidase
Entry information : HpinGPx01
Entry ID 11334
Creation 2012-09-24 (Gisèle Passaia )
Last sequence changes 2012-09-24 (Gisèle Passaia )
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2012-10-03 (Christophe Dunand)
Peroxidase information: HpinGPx01
Name HpinGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hydnomerulius
Organism Hydnomerulius pinastri    [TaxId: 388859 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HpinGPx01
start..stop		 S start..stop
PrubGPx01 320 2.4e-113 1..166 56..221
GliviGPx01 317 2.61e-113 1..167 1..167
PadelGPx01 317 4.04e-113 1..167 1..167
PinvGPx 305 9.05e-108 1..164 59..222
Gene structure Fichier Exons►


exon

Literature and cross-references HpinGPx01
Protein sequence: HpinGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   166
PWM (Da):   %s   18529.17  
PI (pH):   %s   7.18
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSTTSFYDLKTDLPNGTTYDFDQLKGKVVLIVNVASQCGFTPQYKGLQALYDKYKERGFVILGFPCNQFGGQEPGDDATIASFCERNHGVTFPLMKKSDVNGDNTNSVYQYLKNEKAGI
MGLTRIKWNFEKFLIDQEGKVVNRWASTTTPQAIDAAVEKFYAGSQ*

Retrieve as FASTA  
Remarks Complete sequence from geomic (4 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST