Entry information : EglPrx17
Entry ID 11359
Creation 2012-11-09 (Qiang Li)
Last sequence changes 2012-11-09 (Qiang Li)
Sequence status partial
Reviewer Achraf Jemmat
Last annotation changes 2016-03-08 (Achraf Jemmat)
Peroxidase information: EglPrx17
Name EglPrx17
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus globulus    [TaxId: 34317 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EglPrx17
start..stop
S start..stop
EgrPrx20 508 0 1..247 73..319
EglPrx20 503 0 1..247 34..280
EgrPrx18 492 1.02e-178 1..247 73..319
EguPrx17 490 5.81e-178 1..247 73..319
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11359' 'join(101..292,413..578,699..1084)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 101..292 190 N° 2 413..578 164 N° 3 699..1084 384  
join(101..292,413..578,699..1084)


exon

Literature and cross-references EglPrx17
Protein sequence: EglPrx17
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   247 (294)
PWM (Da):   %s   26225.98 (31784.4)  
PI (pH):   %s   7.43 (4.71) Peptide Signal:   %s   cut: 26 range:26-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCDASILLDDTTNFTGEKNAGPNANSMRGFEVIDTIKSELESKCP
SIVSCADILAVVARDSIVA
LGGPSWTVNLGRRDSTTASQSAANISIPPPTLNLSGLISTFSNKGFTAKEMVALLGSHTIGQARCLTFREHLYNENNIDATFATSLKANCPSSGGDSKLFPFDTTSPTSFDNAFFKNLQT
HKVFLHSDQQLFSGGSTDVHVNAYSSNLSTFRTDFANAMVKMGNLSPLIGSSGQIRKNCRKVN

Retrieve as FASTA  
Remarks Partial sequence from genomic. Exon 1 is missing.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGATGCGACGCGTCAATTTTATTGGACGACACTACGAACTTTACCGGGGAGAAGAACGCCGGCCCGAATGCCAATTCCATGCGGGGATTTGAGGTAATCGACACAATCAAGTCCGAATTG
GAGAGCAAGTGCCCCAGTATTGTGTCCTGCGCTGATATTTTAGCCGTCGTTGCACGAGACTCCATCGTTGCC
CCGTAAGTGCACATTTTCTTCTCAATTGTACTTATCAATTGTGATGAA
AAAAATCACATGTTATGTTCCCCATGCTATATTAATACTAACACGTATGGATTTGTTATTTATTTAATTTTTAGTTAGGTGGCCCTAGTTGGACAGTCAACCTTGGAAGAAGAGACTCAA
CCACTGCAAGTCAAAGTGCTGCTAATATTAGCATTCCTCCCCCAACTTTGAACCTTAGCGGCCTAATCTCTACCTTCTCTAACAAAGGCTTCACAGCTAAAGAAATGGTGGCACTTTTAG
AGGTCATTGTTTCTTTTCTTTTTTTTTCTTCTTTTTTTTGCAATATTTAATAAAGAATAACAATAATGCTCGATCAATATACTAAAATCAATTTACAAAAATTGTTCGACCATTGTTAAC
AGGGTCGCACACTATAGGTCAAGCCCGATGCCTGACTTTCCGGGAGCATCTTTACAATGAGAACAACATCGATGCCACGTTCGCGACATCGCTGAAAGCAAATTGCCCAAGCTCCGGAGG
CGACAGCAAACTCTTTCCTTTTGACACCACAAGCCCGACGTCCTTTGACAACGCCTTCTTCAAGAACTTGCAAACCCACAAGGTTTTTCTTCATTCGGACCAGCAATTGTTCAGTGGTGG
CTCCACGGACGTTCACGTGAATGCTTATAGTAGCAATTTGTCCACTTTTAGGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTTAGCCCACTCATTGGCTCAAGCGGTCAGAT
TAGAAAGAATTGCAGGAAAGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGATGCGACGCGTCAATTTTATTGGACGACACTACGAACTTTACCGGGGAGAAGAACGCCGGCCCGAATGCCAATTCCATGCGGGGATTTGAGGTAATCGACACAATCAAGTCCGAATTG
GAGAGCAAGTGCCCCAGTATTGTGTCCTGCGCTGATATTTTAGCCGTCGTTGCACGAGACTCCATCGTTGCC
TTAGGTGGCCCTAGTTGGACAGTCAACCTTGGAAGAAGAGACTCAACC
ACTGCAAGTCAAAGTGCTGCTAATATTAGCATTCCTCCCCCAACTTTGAACCTTAGCGGCCTAATCTCTACCTTCTCTAACAAAGGCTTCACAGCTAAAGAAATGGTGGCACTTTTAG
GG
TCGCACACTATAGGTCAAGCCCGATGCCTGACTTTCCGGGAGCATCTTTACAATGAGAACAACATCGATGCCACGTTCGCGACATCGCTGAAAGCAAATTGCCCAAGCTCCGGAGGCGAC
AGCAAACTCTTTCCTTTTGACACCACAAGCCCGACGTCCTTTGACAACGCCTTCTTCAAGAACTTGCAAACCCACAAGGTTTTTCTTCATTCGGACCAGCAATTGTTCAGTGGTGGCTCC
ACGGACGTTCACGTGAATGCTTATAGTAGCAATTTGTCCACTTTTAGGACAGATTTTGCTAACGCCATGGTGAAGATGGGTAACCTTAGCCCACTCATTGGCTCAAGCGGTCAGATTAGA
AAGAATTGCAGGAAAGTCAACTGA

Retrieve as FASTA