Entry information : McirCcP03
Entry ID 11372
Creation 2012-12-13 (Christophe Dunand)
Last sequence changes 2012-12-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-12-13 (Christophe Dunand)
Peroxidase information: McirCcP03
Name McirCcP03
Class Cytochrome C peroxidase    [Orthogroup: CcP012]
Taxonomy Eukaryota Fungi Mucoraceae Mucor
Organism Mucor circinelloides    [TaxId: 36080 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value McirCcP03
start..stop
S start..stop
RoCcP01 546 0 1..415 1..364
McirCcP02 434 4e-152 1..413 1..369
RoCcP02 426 4e-149 12..412 14..363
PblCcP01 400 1e-138 127..416 81..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2504796..2504970 175 N° 2 2505027..2505327 301 N° 3 2505379..2505631 253 N° 4 2505692..2505817 126
N° 5 2505879..2506274 396  
join(2504796..2504970,2505027..2505327,2505379..2505631,2505692..2505817,2505879 ..2506274)


exon

Literature and cross-references McirCcP03
DNA ref. JGI genome:   scaffold_05 (2504796..2506274)
Cluster/Prediction ref. JGI gene:   144801 [Incorrect prediction]
Protein sequence: McirCcP03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   416
PWM (Da):   %s   46560.13  
PI (pH):   %s   6.42
Sequence 457
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSLRSVGCLASRYGARQIIRPAALTANVRKSIIMRRGYATAPPAGNNSSGSNPLLWIGCISLGAAYTYYQKKRAEQIDQAVHKDQLENTANASASASKTEEKKEDPKPKSESESKDNKDTKKEPTNKPDDSKKTAPEKEINYQQVYNDIAELLDSNEDYDDGSYGPVLLRLAWHSSGTYNKEDGSGGSNGGTMRFRAEAEHAANNGLQVARDLLEKHIKPKYPELSYGDMYTLGGVVAIQELGGPNIKWRPGRRDQGDNKCTPDGRLPDGSKKADHVRDIFYRMGFNDREIVALTGGHALGRCHLDRSGYDGPWQEAPTFFSNEYYKAITSREWVKRDLPNGLWQWVDKANPEVMMLPIEITMLEDEKLKPYFELYAKDTAVFFEDFANAFKKLIELGVPFTGDEKEYVFERLNM

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). Incorrect prediction from JGI (first exon is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCTTCTTTACGCTCAGTTGGATGCCTAGCAAGTCGCTACGGAGCGCGTCAAATCATCCGCCCAGCAGCATTGACAGCCAATGTCCGTAAGTCAATCATCATGCGTCGCGGCTACGCAA
CAGCTCCTCCAGCAGGAAACAATAGCTCAGGCTCCAATCCTTTATTATGGATCG
GTAAGTAGTGTAGCTATATAGGCTGCATGATAGACTCATCATGCGTGCGTGAACAGGTTGTATTTC
CCTTGGTGCTGCTTATACCTATTATCAAAAGAAGAGAGCAGAACAAATCGACCAAGCTGTTCACAAAGACCAGCTCGAGAATACTGCAAATGCATCTGCTTCAGCCTCCAAAACAGAGGA
GAAGAAGGAGGATCCTAAACCAAAGAGTGAATCAGAATCAAAAGACAACAAGGACACCAAAAAGGAACCCACCAACAAGCCTGATGATTCCAAAAAGACGGCTCCTGAGAAGGAGATTAA
TTATCAACAGGTCTACAATGACATTGCCGAGCTGCTAGACTCTAATGAAGA
GTAAGTGTGTTGGTATCAAAAGGATAGGCAAAGTGTCTAATCAAGGTGTAGCTATGATGATGGATCGTA
CGGACCCGTTCTTTTGCGTCTTGCCTGGCATTCATCGGGCACCTACAATAAGGAAGATGGTTCTGGTGGCAGCAATGGTGGCACAATGCGTTTCAGAGCCGAGGCAGAACATGCTGCTAA
CAATGGCTTGCAAGTCGCTCGTGATCTTCTTGAAAAGCATATCAAGCCAAAGTATCCCGAACTTAGTTATGGTGACATGTACACCTTGGGTGGTGTCGTTGCTATCCAAGAGCTG
GTGAG
TTTTGTAAATTTATTGCCTGGTCATCGAGTTCTGTACTGAACTGGATATATTTAGGGCGGCCCCAACATCAAATGGAGACCTGGTCGCAGAGATCAAGGCGACAACAAATGTACCCCAGA
TGGTCGTCTTCCTGACGGATCCAAGAAGGCTGATCATGTGCGTGATATCTTTTATCGTATG
GTAAAGTTTGGCAAACGAAATCATGCGATTATCACCGAATACTTAACACTCTTCCTATT
AGGGATTTAATGATCGTGAAATTGTTGCATTGACTGGCGGTCATGCTTTAGGCAGATGTCATTTGGATCGCAGTGGCTACGACGGACCATGGCAAGAAGCACCCACTTTCTTCTCCAACG
AATATTACAAGGCCATCACCTCTCGTGAATGGGTCAAGAGAGATCTCCCCAATGGCTTGTGGCAATGGGTCGACAAAGCCAACCCCGAAGTCATGATGTTGCCTATTGAAATCACCATGC
TGGAGGATGAAAAGCTGAAGCCTTATTTCGAACTGTATGCAAAGGACACTGCCGTCTTCTTTGAAGATTTTGCCAATGCCTTTAAAAAGTTGATTGAATTGGGTGTGCCTTTCACAGGAG
ACGAAAAGGAGTATGTTTTTGAAAGACTCAACATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTCTTCTTTACGCTCAGTTGGATGCCTAGCAAGTCGCTACGGAGCGCGTCAAATCATCCGCCCAGCAGCATTGACAGCCAATGTCCGTAAGTCAATCATCATGCGTCGCGGCTACGCAA
CAGCTCCTCCAGCAGGAAACAATAGCTCAGGCTCCAATCCTTTATTATGGATCG
GTTGTATTTCCCTTGGTGCTGCTTATACCTATTATCAAAAGAAGAGAGCAGAACAAATCGACCAAG
CTGTTCACAAAGACCAGCTCGAGAATACTGCAAATGCATCTGCTTCAGCCTCCAAAACAGAGGAGAAGAAGGAGGATCCTAAACCAAAGAGTGAATCAGAATCAAAAGACAACAAGGACA
CCAAAAAGGAACCCACCAACAAGCCTGATGATTCCAAAAAGACGGCTCCTGAGAAGGAGATTAATTATCAACAGGTCTACAATGACATTGCCGAGCTGCTAGACTCTAATGAAGA
CTATG
ATGATGGATCGTACGGACCCGTTCTTTTGCGTCTTGCCTGGCATTCATCGGGCACCTACAATAAGGAAGATGGTTCTGGTGGCAGCAATGGTGGCACAATGCGTTTCAGAGCCGAGGCAG
AACATGCTGCTAACAATGGCTTGCAAGTCGCTCGTGATCTTCTTGAAAAGCATATCAAGCCAAAGTATCCCGAACTTAGTTATGGTGACATGTACACCTTGGGTGGTGTCGTTGCTATCC
AAGAGCTG
GGCGGCCCCAACATCAAATGGAGACCTGGTCGCAGAGATCAAGGCGACAACAAATGTACCCCAGATGGTCGTCTTCCTGACGGATCCAAGAAGGCTGATCATGTGCGTGATA
TCTTTTATCGTATG
GGATTTAATGATCGTGAAATTGTTGCATTGACTGGCGGTCATGCTTTAGGCAGATGTCATTTGGATCGCAGTGGCTACGACGGACCATGGCAAGAAGCACCCACTT
TCTTCTCCAACGAATATTACAAGGCCATCACCTCTCGTGAATGGGTCAAGAGAGATCTCCCCAATGGCTTGTGGCAATGGGTCGACAAAGCCAACCCCGAAGTCATGATGTTGCCTATTG
AAATCACCATGCTGGAGGATGAAAAGCTGAAGCCTTATTTCGAACTGTATGCAAAGGACACTGCCGTCTTCTTTGAAGATTTTGCCAATGCCTTTAAAAAGTTGATTGAATTGGGTGTGC
CTTTCACAGGAGACGAAAAGGAGTATGTTTTTGAAAGACTCAACATGTAA

Retrieve as FASTA