Entry information : McirCcP04
Entry ID 11373
Creation 2012-12-13 (Christophe Dunand)
Last sequence changes 2012-12-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-12-13 (Christophe Dunand)
Peroxidase information: McirCcP04
Name McirCcP04
Class Cytochrome C peroxidase     [Orthogroup: CcP002]*
Taxonomy Eukaryota Fungi Mucoraceae Mucor
Organism Mucor circinelloides    [TaxId: 36080 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value McirCcP04
start..stop
S start..stop
PblCcP02 346 4.03e-121 8..266 10..268
McirCcP01 345 1.09e-120 8..266 11..269
RoCcP03 332 8.57e-116 8..266 11..267
UramCcP01 332 2.46e-115 8..266 10..268
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11373' 'join(239113..239210,239285..239473,239530..240085)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 239113..239210 96 N° 2 239285..239473 187 N° 3 239530..240085 554  
join(239113..239210,239285..239473,239530..240085)


exon

Literature and cross-references McirCcP04
DNA ref. JGI genome:   scaffold_12 (239113..240085)
Cluster/Prediction ref. JGI gene:   115916
Protein sequence: McirCcP04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   280 (301)
PWM (Da):   %s   32069.48 (32977.6)  
PI (pH):   %s   5.4 (8.21) Peptide Signal:   %s   cut: 28 range:28-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSKVGDYNAVRKDIIAAIPTERYDKGTFGPSMIRLTWHSCATYDRHQNNGGSQGGTMRFEEQYSDPANKGLENARNALEPVHEKHPWITYADLYTLGGCVAVEQMGGPHIPWEGGRYDT
DDKDSIPSRNRLPDGSLGKNHVIDVFLDRLGMSVQETVALMGAHAVGECHKSHQGFDGPWTPNQTEFTNNFYKMLLERTWKEKKWDGPRQFEDEETHELMMLPTDMVMLQEPFLEYTKLY
AEDQDRFFEDFKNAMLKLISLGKDRKDGEPNKLLAQYCKK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAAGTAAAGTTGGTGACTACAATGCCGTGAGAAAGGATATCATTGCTGCCATTCCAACAGAGCGATACGATAAAGGCACATTTGGGCCATCCATATGTAAGCATTTGATGATATGA
GATGACGGTATATGGCGTGGTTGACTAATAATAGGGCTAATACATAATACATAGGATTCGTTTGACATGGCACTCATGTGCTACGTATGATCGCCATCAAAACAATGGAGGAAGTCAGGG
TGGCACCATGCGCTTTGAAGAGCAATACTCGGATCCTGCTAATAAAGGCCTGGAAAATGCCAGAAACGCATTGGAGCCTGTACATGAAAAGCATCCCTGGATTACATACGCAGATCTATA
CAC
ACGTGAGTATTGCAGTCTGTGCAGTGTGTATGCACATATACTGATCTGATATATCCAGTCTCGGTGGTTGTGTTGCAGTGGAGCAAATGGGCGGTCCTCACATCCCCTGGGAAGGCG
GCCGATACGACACCGACGACAAGGACAGCATACCATCTCGTAACCGCTTACCCGATGGCTCACTCGGCAAAAACCATGTCATTGATGTCTTTCTGGATCGTTTGGGCATGTCAGTGCAAG
AAACAGTGGCATTGATGGGCGCTCATGCAGTGGGTGAGTGCCACAAAAGCCATCAGGGATTTGACGGACCATGGACACCAAATCAGACTGAATTCACCAACAATTTCTACAAGATGCTGC
TGGAACGCACATGGAAGGAAAAGAAGTGGGATGGCCCTAGACAGTTTGAAGATGAAGAGACTCATGAGCTGATGATGCTGCCCACAGACATGGTCATGCTACAAGAACCCTTCTTGGAGT
ATACAAAACTGTATGCTGAGGATCAAGATAGGTTCTTTGAGGACTTCAAGAATGCAATGCTCAAGTTGATATCCTTGGGCAAAGATCGCAAAGATGGTGAGCCCAACAAGTTGTTGGCAC
AGTATTGCAAAAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACAAGTAAAGTTGGTGACTACAATGCCGTGAGAAAGGATATCATTGCTGCCATTCCAACAGAGCGATACGATAAAGGCACATTTGGGCCATCCATGATTCGTTTGACATGGCACTCA
TGTGCTACGTATGATCGCCATCAAAACAATGGAGGAAGTCAGGGTGGCACCATGCGCTTTGAAGAGCAATACTCGGATCCTGCTAATAAAGGCCTGGAAAATGCCAGAAACGCATTGGAG
CCTGTACATGAAAAGCATCCCTGGATTACATACGCAGATCTATACAC
TCTCGGTGGTTGTGTTGCAGTGGAGCAAATGGGCGGTCCTCACATCCCCTGGGAAGGCGGCCGATACGACACC
GACGACAAGGACAGCATACCATCTCGTAACCGCTTACCCGATGGCTCACTCGGCAAAAACCATGTCATTGATGTCTTTCTGGATCGTTTGGGCATGTCAGTGCAAGAAACAGTGGCATTG
ATGGGCGCTCATGCAGTGGGTGAGTGCCACAAAAGCCATCAGGGATTTGACGGACCATGGACACCAAATCAGACTGAATTCACCAACAATTTCTACAAGATGCTGCTGGAACGCACATGG
AAGGAAAAGAAGTGGGATGGCCCTAGACAGTTTGAAGATGAAGAGACTCATGAGCTGATGATGCTGCCCACAGACATGGTCATGCTACAAGAACCCTTCTTGGAGTATACAAAACTGTAT
GCTGAGGATCAAGATAGGTTCTTTGAGGACTTCAAGAATGCAATGCTCAAGTTGATATCCTTGGGCAAAGATCGCAAAGATGGTGAGCCCAACAAGTTGTTGGCACAGTATTGCAAAAAA
TAA

Retrieve as FASTA