Entry information : Egu1CysPrx03
Entry ID 11374
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-24 (Christophe Dunand)
Peroxidase information: Egu1CysPrx03
Name Egu1CysPrx03
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Egu1CysPrx03
start..stop
S start..stop
Egr1CysPrx03 458 2.2e-167 1..220 1..220
Ecam1CysPrx03-2 453 2.16e-165 1..220 1..220
Ecam1CysPrx03-1 452 8.81e-165 1..217 1..217
Egl1CysPrx03-1 414 4.03e-150 19..216 1..198
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11374' 'complement(join(4099..4347,4477..4623,5124..5272,5386..5503))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5386..5503 116 N° 2 5124..5272 147 N° 3 4477..4623 145 N° 4 4099..4347 247
complement(join(4099..4347,4477..4623,5124..5272,5386..5503))


exon

Literature and cross-references Egu1CysPrx03
Protein sequence: Egu1CysPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220 (315)
PWM (Da):   %s   24227.5 (34974.7)  
PI (pH):   %s   8.09 (8.85) Peptide Signal:   %s   cut: 27 range:27-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGLTLGDTVPDLAVETTHGKMKLHDYIGGAWTVLFSHPGDFTPVCTTELGKMAAYAPEFERRGVKLLGLSCDEVESHKAWIKDIEAFPGAKVTYPIIADPNREIIKQLNMVEPEEKDASGKQVPSRALHIVGPDKKIKLSFLYPASTGRNMDEVVRVL
ESLQRATKHKIATPCNWKPGEAVVISPSVSNEQAKEMFPQGYKTANLPSKKDYLRFTHVD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_7_25036 (5503..4099)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGCCTGACGCTCGGCGACACCGTCCCGGACCTCGCCGTCGAGACCACCCACGGCAAGATGAAGCTCCACGACTACATCGGCGGCGCCTGGACCGTCCTCTTCTCTCACCCCGGT
AACCGTCGTCGTCGTCGTCGTCGTCGTCGTCTCTCCTTTTGCCCGACTCCTCATGTTTCGACGGCCCCGAGAAAAGGGAAGNCTTGTTCACCCACGACATCGCTTGCGCAGGGGGGATTT
CACGCCGGTGTGCACGACGGAGCTCGGGAAGATGGCGGCGTACGCGCCGGAGTTCGAGCGGCGAGGGGTGAAGCTCCTGGGCTTGTCCTGCGACGAGGTCGAGTCGCACAAGGCGTGGAT
CAAGGACATAGAGGCCTTCACN
GTCAGCTACTCTTCTCCCTATTAAACCTTTTTTTTATCACTTGGCANATGTGTATTTGCATGTCTTGTAGGAACTTGCTTTTTTGGATTTTGATGTTG
TGTTTTATCTGGTTTTGGTGATAGTATCCTTCAGAAAGAAAAAGAAAGAGAACTTATAGGAATGTGTNGNNNNNNNNNNNNNNNNNNNTTGCATGTCTTGTAGGAACTTGCTTTTTGGGA
TTTTGATGTTGTGTTTTATCTGGTTATGGTGATAGTATCCTTCAGAAAGAAAAAGAAAGAGAACTTATAGGAATGTGTNGTATTATGATTTAGTAGAGTGACCAAGGGAAGTCTCCTTAA
TCTTAGGCACNATTTGGGTAGAATGAGGTGGTTTAATTGCGGGTCACAGGGCTGACTGTTCTGTTTCACATTTGAGATTGGGACCTTTGGCTTTTGTNCAANTTTCATNATTCCAATTTC
GAGCCNACATTCTCAATGTCGTGTTATTTGGTGGGGNTGTAGCCCCTGGTGCTAAGGTGACGTACCCGATAATCGCCGACCCGAATAGAGAGATAATCAAACAGCTCAACATGGTCGAGC
CNGAGGAGAAAGACGCCTCNGGGAAGCAAGTCCCTTCTAGAGCTCTGCACATCGTCGGTCCTGATAAGAAG
GTATACNTGCTCNTCTNAACTTTTCTATTCCGTGTTAATCAAACTTTNA
TCGGATGAAACAAATTGCATAAACCAATGTCATCTCATGCATGTCNTTTTCGNTTTCACGNTATAACATNAATTGTATAGATATCAAGCTGAGTTTTCTGTACCCGGCGAGCACGGGGAG
GAACATGGACGAGGTGGTGAGGGTGCTGGAATCGCTGCAGAGGGCGACGAAGCACAAGATCGCCACCCCGTGCAACTGGAAGCCGGGGGAGGCAGTTGTCATCTCACCGTCCGTCTCCAA
CGAGCAGGCCAAGGAGATGTTCCCGCAGGGCTACAAGACCGCCAATCTCCCGTCCAAGAAGGATTACCTCCGCTTCACTCATGTTGATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCAGGCCTGACGCTCGGCGACACCGTCCCGGACCTCGCCGTCGAGACCACCCACGGCAAGATGAAGCTCCACGACTACATCGGCGGCGCCTGGACCGTCCTCTTCTCTCACCCCGGG
GATTTCACGCCGGTGTGCACGACGGAGCTCGGGAAGATGGCGGCGTACGCGCCGGAGTTCGAGCGGCGAGGGGTGAAGCTCCTGGGCTTGTCCTGCGACGAGGTCGAGTCGCACAAGGCG
TGGATCAAGGACATAGAGGCCTTCACN
CCTGGTGCTAAGGTGACGTACCCGATAATCGCCGACCCGAATAGAGAGATAATCAAACAGCTCAACATGGTCGAGCCNGAGGAGAAAGACGCC
TCNGGGAAGCAAGTCCCTTCTAGAGCTCTGCACATCGTCGGTCCTGATAAGAAG
ATCAAGCTGAGTTTTCTGTACCCGGCGAGCACGGGGAGGAACATGGACGAGGTGGTGAGGGTGCTG
GAATCGCTGCAGAGGGCGACGAAGCACAAGATCGCCACCCCGTGCAACTGGAAGCCGGGGGAGGCAGTTGTCATCTCACCGTCCGTCTCCAACGAGCAGGCCAAGGAGATGTTCCCGCAG
GGCTACAAGACCGCCAATCTCCCGTCCAAGAAGGATTACCTCCGCTTCACTCATGTTGATTAG

Retrieve as FASTA