Entry information : EguAPx[P]05
Entry ID 11381
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: EguAPx[P]05
Name EguAPx[P]05
Class Ascorbate peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguAPx[P]05
start..stop
S start..stop
EgrAPx[P]05 257 1.52e-90 1..132 1..132
EgrAPx[P]06 256 5.56e-90 1..132 1..132
EglAPx[P]06 248 4.84e-87 1..124 1..124
EgrAPx[P]04 228 1.88e-78 1..117 40..156
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11381' 'complement(join(5634..5798,6376..6478,6568..6647,6734..6784))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6734..6784 49 N° 2 6568..6647 78 N° 3 6376..6478 101 N° 4 5634..5798 163
complement(join(5634..5798,6376..6478,6568..6647,6734..6784))


exon

Literature and cross-references EguAPx[P]05
Protein sequence: EguAPx[P]05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   132 (176)
PWM (Da):   %s   13983.23 (19464.9) Transmb domain:   %s   i109-131o
PI (pH):   %s   4.72 (7.18) Peptide Signal:   %s   cut: 27 range:27-202
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGLSDKDIVALSGAHTLGRAHQERSGFDGPWTQEPLEFDNSYFVELLKGEAEGLLKLPTDKALLENPAFRPYVELYADEDAIFRDYAISHKKLSELGFTPSSSGSKTVANGAILAQGAVGVAVAAAVVILS*

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic (3' end is missing). Scaffold_5_14900 (6784..5634).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGACAAGGACATAGTGGCCTTATCAGGGGCTCATACACTGGTAATTTCTATTTCTGCTTGGATTTACATTCAAGGTCAGCTGGGGATGCGTAACCACACTTGTTATTTT
TTTATTCTTGTGTCAAGGGGGAAGGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTGAGTTTGATAATTCCTATTTTGTGTAAGATTTCATCTTTTCACT
GGATGCATTTTCTAAGTTTCGGCTGGAGCATTATAGAGCCAGATACTAATTGATCATTTTTGACACAGCGCGAGTTGTTGAAAGGGGAAGCAGAGGGGCTGCTGAAACTGCCAACTGACA
AGGCATTGCTGGAAAATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAG
GTAAATAAGCTTTTCGCGTGGTCTNGTGACTCCATCGATAAATCTATAAAATTGAATTGCAGTTACA
TGGTTTCCTTTTGTAAATTTGTTTTTGATGAAACTACCCTGCCCACACCACTATTTCGTTTCCTTATGCTCATGGTCTATAACCCTTTGATGCTACTGTCCTTGGTTTTGCCGAGAATGA
AAAGAGATGGAAAGTGTTTTTCATGGAATTTATGCTGTGTAGGCTTGTGATGCTTAAAAGTAAGCATTNAGTATGTTCCATCACTATCTTCTATGTAGAGACCAGGAAATATTCATGATG
AGATCGCACATCAAATGTTGGGTAGATACATACATGTGTTGGGATGGATATATTATGTGGTTCCCTGAAACCTCTAGGCTAGAGCATCATCTTTGTGCTACTGGGAACACTTGATTTGAT
ATTTGAATTGGTTGTTGTTCCCGCAACTCTCTCATGGTGGTTGGCACGACCTTGAAAAGAGACAAACGGACAATTTGATACCGTGCTTCTTTTCCTCGTTTTCTTTTGCTATATGCTCTT
CTTTCCCTAATGTTGTCAAGCATGTGGCANGAGATGAGGATGCAATTTTCAGAGATTATGCAATCTCGCATAAGAAGCTCTCTGAACTGGGGTTCACGCCAAGTTCTTCAGGCAGCAAGA
CAGTAGCGAATGGTGCCATATTGGCACAAGGTGCTGTTGGAGTGGCAGTGGCTGCGGCTGTGGTGATCTTGAGCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCTCTCGGACAAGGACATAGTGGCCTTATCAGGGGCTCATACACTGGGAAGGGCACACCAGGAAAGATCTGGATTTGATGGTCCTTGGACTCAGGAACCCCTTGAGTTTGATAAT
TCCTATTTTGT
CGAGTTGTTGAAAGGGGAAGCAGAGGGGCTGCTGAAACTGCCAACTGACAAGGCATTGCTGGAAAATCCTGCATTTCGCCCTTATGTTGAGTTGTATGCGAAGGATGAG
GATGCAATTTTCAGAGATTATGCAATCTCGCATAAGAAGCTCTCTGAACTGGGGTTCACGCCAAGTTCTTCAGGCAGCAAGACAGTAGCGAATGGTGCCATATTGGCACAAGGTGCTGTT
GGAGTGGCAGTGGCTGCGGCTGTGGTGATCTTGAGCTAG

Retrieve as FASTA