Entry information : EguGPx05
Entry ID 11392
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-02-14 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: EguGPx05
Name EguGPx05
Class Plant glutathione peroxidase    [Orthogroup: Gpx2011]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguGPx05
start..stop
S start..stop
EgrGPx05 346 2.17e-124 1..168 1..168
EcamGPx05 326 1.77e-116 1..165 1..165
EgrGPx06 303 1.67e-106 1..167 83..249
EguGPx06 302 5.7e-106 1..167 83..249
Gene structure Fichier Exons


exon

Literature and cross-references EguGPx05
EST ref. GenBank:   CU400247.1 [3' end]
Protein sequence: EguGPx05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   173
PWM (Da):   %s   19109.63  
PI (pH):   %s   8.77
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTSQSQKASVHDFTVKDARGNDVNLSQYRGKVLLIVNVASQCGLTNSNYTELSKLYEKYRNQGLEILAFPCNQFGSQEPGTNEQIQEFACTRFKAEYPVFSKVDVNGANADPLYKHLKSS
KGGFFGDGIKWNxSKFLVDKEGNVVNRYAPTTSPLSFEKDVKKLLGVELGSSF*

Retrieve as FASTA  
Remarks Complete sequence from genomic. Scaffold_4_13895 (45870..43651)
DNA
Send to BLAST
CDS
Send to BLAST