Entry information : EguGPx08
Entry ID 11393
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-19 (Christophe Dunand)
Peroxidase information: EguGPx08
Name EguGPx08
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguGPx08
start..stop
S start..stop
EgrGPx08 338 3.08e-121 1..170 1..170
EcamGPx08 329 6.45e-118 1..170 1..169
EglGPx08 326 1.38e-116 1..170 1..170
EguGPx09 262 1.84e-91 1..170 1..170
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11393' 'complement(join(17310..17342,17462..17629,20061..20179,21104..21165,21280..21356,21480..21533))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21480..21533 52 N° 2 21280..21356 75 N° 3 21104..21165 60 N° 4 20061..20179 117
N° 5 17462..17629 166 N° 6 17310..17342 31  
complement(join(17310..17342,17462..17629,20061..20179,21104..21165,21280..21356 ,21480..21533))


exon

Literature and cross-references EguGPx08
Protein sequence: EguGPx08
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   18590.43  
PI (pH):   %s   7.92
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGAAQSAxEKSLHQFVVKDSKGNEVNLSAYEGKVLLVVNVASKCGFTEQNYTQLAELHxRYKDKGxEILAFPCNQFLxQEPDTSQEVEDFACNRYNVEFPIFQKVCVNGQETAPLYKYLK
ARKTGFFGSRIKWNFTKFLxDKEGRVISRYGTITPPLAIEEDIQKALGMA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_8_27041 (21533..17310)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCCGCCCAATCCGCGGNCGAGAAATCCCTCCACCAGTTCGTCGTCAAGGTGGGCGTGTCGCTGCGCGAATCGTTCGCGAATCTCTCTTTCACGGGCTCGAAATTTACGTGGAAT
CGCGATGTTTTGATGTTAATGCTGATGCTGATGATGATGATGATGATGATGATGCAGGAGACAGCAAGGGCAATGAGGTGAATCTCAGTGCTTACGAAGGGAAGGTTCTTCTCGTCGTGA
ACGTTGCTTCCAAATG
GTCTCTCTCACCCACCTCTCTCTTCTCATCAATTTTCTTCCTTTTTTTTTTTAGTGATGCGTTCGCTCTCAAACTAACAAGATTGATCTGTGGGTGTTTGTGGG
TTTGAAACAGTGTGGGTTCACCGAACAGAACTACACGCAGCTCGCTGAACTTCACNATAGGTACAAGGATAAAGGTCGGTTCTTTCGCCATTTTCTGTTCGGTTGCATTTTGTTGCATTC
ATGGATGTCGTCTTTTGTTATAATGGGTATGTTTCCGTGGTNATTATCATGGGAATTCCTACATTTTTCGACCNTGCAATGGAAGTAAGTATGGTGATGGGTGACTAGCACNATCAGTTG
AGCTTGTAAGTGGGGAAAGAAAACCATAGAAAGAAATACTGTATGTTTATGCCCCAAAAAATAGGAAAANTGCAAAATCAACCAGTGTTGGGGTACTCAAACATCTTCATGAGAAGCTAA
ATAGCCNGGTGCTGTAAATGTTGGCCAAGTGATGCATAAATTGTCTTTATACTGCTTTTGTCCGAGGTATACNNTCCGANAAGATCATGAGGATGAATCGAGTCGAACCGAATTTTGTCT
TCTACATTTATTAACCTACTGCTTTTTCCAATTTCTTTTTGTAACTGCTCCAATGCTTGATGATGCACTACTCTGCCTTGGCATCTTTGCTGGGGTTGCGGTCACTTCTAGGGGGTTGGC
CATGCATGCAAGTAAGAATCAGATAACTTGGGATGATCNANTCAACCCAANTAATTGCAGATGNCAATTTTGAGCTTCATTTCCTTCTGGAAATCCCTATTCATTGTCAATCTGNANAGC
ACTTGTTCTTCGTCTNATGTTGCAATAATCTCTTTGCTTTGTTCATCGTCTGTTNGGAAAATTGTGAACATTCGTAATAATTTGTCCCTCATGCTGTGCATTGCCATGGAAAGTTCTTTC
CACTGGAAATTTTTAAATAGAGNGTAGTCATTTTCTATATTGATTATTCCAAAGAAAGATCATAACNTGCACTGCCGACCTTTCCTTCTTAGCCCCTCCCAAGATGAGTTTAATGAGTTT
GAAATTGAAGGGAATGGCTGCTCCTGGGTTTTTCTCAGGAGATTNGAAATCTTGGCATTTCCATGCAACCAATTTCTCANACAAGAGCCAGACACTAGCCAGGAGGTGGAAGATTTTGCT
TGTAACAGATACAATGTCGAATTTCCAATTTTCCAGAAG
GTATGCTTTTTAGCTGCTCTCTCNCAACTGTTTAGCTTTTCAGATTGATCATTTGAATTGTTATTTTATCAACTAGGTCCA
TTTCTTTGTATGTTCCCCTCCTCTTGTNTGTTTCTGCCAGGCAGTTATATAGATTTCCAAGATCTCTTCTTTCTTTTCGGCTCTAATTGGTTGCCGTGGCCTATGACTGAACTGATGCTT
TTGTCTCTCAATAATTACTTNTTTTTGTTGCTTCTCCNCAGGGTGCAAACTCTACGAAATCATGACTTATCTATTGTGGTCTTTGATNTTTATCAATGGTTAATAAGTGGGTCGAAATGT
TTGTAGTCATAGGACTTGTGGCCATTTTAGTTGGAATTCTGGATACCATTGTGCCCTGCTCATTTCTTTATCCCATTTGNGTTTTTTTTGGTTGTATAACATCATCAAGACTCGTGGGAA
TATGTTTCATTAAAACAACCCCCCCACCCCCCAAATAAGAAATTAGAAAATGGTCGCTCCAAACCTGTGAAGCATACCTGCTACCTGCTTTGAAGTTCACACGGTTTGGTAGCCTTTTAA
TACTTGCTGGATANTTCTCTCCTCTGAGTTCCCTGAATTATATAAATATGAGTTATGCAGTAGCATTATTAATTTGTCTGGAAGTGTACATGCTTTGATCTCNTTCTTTTGTCACATCGT
ATCAAGACTGGTTAAAATGTTGAACAAGNTTTATCTAATAGGTCTGGCCNTTTTTCAAGTTGATTCAACCGTCATTTTAGTAGTCAAGAGTTTTGTCATTACATTTNGCAATCAGCTGTG
AAAAATGTTTCAAGAAGTAATTACAGAAGGATTCTTTTTCTTGGANNNTTTAAGGAAAATCTCTCCGTAGAAGGTTAAGAGGTTTTATACCTTGACTGGAGGTTTGGATCACGAGGTACG
TAGAAAATCAAATTGTTAAGAGTTCTTAAACCTTTACTGGAGGTTATGATAANGAGAATCATAGAAGATTCNATTGTTCTATACCTTTGAATTTCTTTTGACTTACTGAAAATCATCAAG
TGTACTGGGACATTGCACATATGCTTGTTATTCTTGTCTTTCATCAGTACTGTCTCTACACTGGGCAAATTATGTGGAGGGAGGAAATAAGGATCAAACCCAAGACATAATTCTTTATAT
GAGTTGGTCACCGCTGGCTGGAAAATTTGTTCTGCATCTTGTACCTGTAATTTTTAGCCAGAATTAACATNGAAATGGCAGAAAGAAAAGGTGAAAGACAAACTGCCAGAGAGGATAAGG
AACAATTAGATTAACCAAAATATAGAAGGCTTCTGGCTAGAAAGTATTGAGGAGAAGTTGCAATACTGGTGTCCTTTCTGTAACACATCCAAAACCGTCTGGCTTCACAACTAAATTTAG
AGGATTACCCAAATGCATTACCCAAACTTGAAGTAAACATATCCAAAATTGAGTAAACACATTATTAACACATTCTTCTTTGAAAAGATCNGTTGTGTAAGCTCCACAGCTTGTACATTG
ATNTACACAACTTATCTTCATTTGTTTCCANATCCACATTTTATTCCATCTGGTGGTATGGCCAAGTCAACCGAGGATTCAGATGACATTTTAGAAAGTCTCTAGGAGAAATACTGTGAA
TTTTTTTGCTTGGACTGCAAGTTTTCAATGATTACGATTTTCCTTGTTGGNGAAGTTATTTACAAAGAAGTCTGTAACCTGATTTCCATCAGGATAGTCCATCTGTTTTCTTTGTTTATT
CAGCAATTATTTTTTAGTTGAGAATACTACCCAAACACATCATCNGTCTTCTGTCACTACCAGTAAAACTCAGACGATCTTTTGGAAAATTATTAGAGAAGAATAATTCGAAAACATTTC
ATAGGTTTGCAATTCTCAGATTCTTTTCAGGGTATGTTCTGTAGAAGAAGATCATAACTTGATCTCTCAGATAAATTCAGCCAGTACTTGACTTCTCACATGAAGAGCGTGGTTTGTTAG
TANGTTTGGCAATGTAGTTGTAATGAGGAAAATGCTTCACACGTTTGGCTTCTCATATTATTAAAGGCTGTACAACTCCCGGTGGTCTAAGATTCACAATCTGCCTCTTGAGGATTGTGG
CCGCTGGGCCTACCCTTATCTTGGGACAAGTCACATCTGATTGCATTATGAGTGTTTGTCGGGAGATTTTTCTAGTTGTTGATAGAAAACTCAAAGTTACCTATTTTTAAGAACTATATC
GACACATATTTACTACTTTATGATTTCTTGGACACTTTTCCTTGTACTCCACATTGCACAGCTCATGATAGATGTAATAGCTCTGTGGGTTTATATACCATAAATATTGGTTATCTCATA
CAATTTGTTTGCTCATTTTGTATGACCAGTCGATTTATTTGAAGTTTTCAGTAGGTGCCTGTGGTTGTAGGTGTTTGCGTCAATGGGCAAGAAACAGCGCCCCTCTACAAATACCTCAAA
GCACGTAAAACTGGATTTTTCGGTTCAAGAATAAAATGGAACTTCACCAAGTTTTTANTAGACAAGGAAGGGCGAGTCATCAGCCGCTACGGAACAATCACACCTCCACTAGCCATCGAG
GTAGCCGACAGTCTGTTCTGGCCCTCAAGTGCTCACTTCTCTGAACCACCCATTTCACTTAGCTTTGCAAGATACTTTTCCTAGCTGTTCGTTGACATTCATGGATATTTTCTATGCAGG
AGAAGACATCCAGAAAGCATTGGGAATGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCCGCCCAATCCGCGGNCGAGAAATCCCTCCACCAGTTCGTCGTCAAGGACAGCAAGGGCAATGAGGTGAATCTCAGTGCTTACGAAGGGAAGGTTCTTCTCGTCGTGAACGTT
GCTTCCAAATG
TGGGTTCACCGAACAGAACTACACGCAGCTCGCTGAACTTCACNATAGGTACAAGGATAAAGGATTNGAAATCTTGGCATTTCCATGCAACCAATTTCTCANACAAGAG
CCAGACACTAGCCAGGAGGTGGAAGATTTTGCTTGTAACAGATACAATGTCGAATTTCCAATTTTCCAGAAG
GTTTGCGTCAATGGGCAAGAAACAGCGCCCCTCTACAAATACCTCAAA
GCACGTAAAACTGGATTTTTCGGTTCAAGAATAAAATGGAACTTCACCAAGTTTTTANTAGACAAGGAAGGGCGAGTCATCAGCCGCTACGGAACAATCACACCTCCACTAGCCATCGAG
GAAGACATCCAGAAAGCATTGGGAATGGCATGA

Retrieve as FASTA