Entry information : EguGPx09
Entry ID 11395
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-19 (Christophe Dunand)
Peroxidase information: EguGPx09
Name EguGPx09
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguGPx09
start..stop
S start..stop
EgrGPx09 346 1.27e-124 1..170 1..170
EglGPx09 330 3.22e-118 1..160 1..160
EcamGPx09 320 1.82e-114 1..160 1..160
NtGPx05-1B 302 4.99e-107 1..170 1..170
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11395' 'complement(join(17353..17385,17511..17678,18709..18827,19257..19318,19441..19517,19607..19660))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19607..19660 52 N° 2 19441..19517 75 N° 3 19257..19318 60 N° 4 18709..18827 117
N° 5 17511..17678 166 N° 6 17353..17385 31  
complement(join(17353..17385,17511..17678,18709..18827,19257..19318,19441..19517 ,19607..19660))


exon

Literature and cross-references EguGPx09
Protein sequence: EguGPx09
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   18630.59  
PI (pH):   %s   9.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGASQSVPEKSIHEFxVKDSRGKDVDLSAYKGKVLLVVNVASKCGFTNSNYTQLTELYNKYKDQGLEILAFPCNQFLKQEPGTSQETQEFACTRFKAEYPIFHKVRVNGPDTAPVYKFLK
ASKSGFLGSGIKWNFTKFLVDKEGHVISRYGTTTSPLAIExEIKKALGEA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_11_38304 (19660..17353)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCTTCGCAGTCGGTCCCCGAGAAATCAATCCACGAGTTCANCGTCAAGGTAAAATACCAGNAACTAACCTTTCTCTGCACTTGCGGTGATGGTGAAGATGACAGACTAATGAGG
TTTATGGGTTATGGTGGGAGCAGGAGACAGTAGAGGGAAGGACGTTGACTTGAGTGCGTACAAAGGGAAGGTCCTCCTCGTTGTTAACGTTGCCTCCAAATGGTATGTCTCTTGCCAATC
CCCTATTTCAGATGGGTTTTTCCTTCGGAATTTTTTTTNTTTTTTTTTGGCTTGTTCTTGTGGAATGAATTTGTTTTTGTTGTTGTTGATTGGTTTGGAAACAGTGTGGATTCACGAATT
CCAACTATACACAGCTCACTGAACTTTACAACAAATACAAAGACCAAG
GTTGGTTGTTTTTTTCCCCCCCTTATTTTCCTGTTCTTTTCCTTTTAAGCTTTTGGGTCTACTCCGTTTGGC
AAATTTTTATAGGTTCGATGATAATTTTTTTGGTGATGTGCTGATGTCTGGGATTTTGCGTGCAAACGGTTACTTTGCTGATGAATTGAGATGTATCGGATGGAGGAAGTTTTAGAAACT
GGCATCAATTGGTTAATTNATGCTGAGGATTTTATCTAATTTTTTTTTTAAACTTCATGGATTCTTCGATTTCTTGAGTTCCTTAATGAATTTCNAGGGAGTCATCGTGTATTTTTTNTT
TTAGGGGACNAAGTTGTTGCGTTGTGGATTTGCTGCAAATGAAAAGTTNAGTTGTTGTTATATCCCTTGCTTATCATAGAATTCCTTAGAGTACTTGGGTGTTGTTGGGTGCCTCAGGTG
TCTTGAGATCTTGGCTTTTCCGTGCAACCAATTTTTGAAACAAGAACCTGGAACAAGTCAGGAGACACAAGAATTTGCATGTACAAGATTCAAAGCTGAATACCCGATCTTCCACAAG
GT
AAGAATTGCTGCTCTGCAATCTTACACTTTTAGTAGCTTCGAGTTGNGAGTGATGTGGACAACTGTTTCTATATTGTGTCACAATACGACTTTGGCAAAAAATAGTTAACCTTGCAAACT
TATGATTGTCTGCCACTTCATCCTGTACAGATGCATGANTAAAATCTTATGTGCTGCTGCNACTANGATGTGGATTTTCTTGTTTGTATATGTTTGCCAAAGTTTACCGNTGGCCTGAGG
AAAATTGATTTTTATTTAACTTGGTCTCCTTTGCGTTTAAATGCAACTAACTGTANTCTTTTTATNGGTATGCTCTTANTTAAATCTTTGTAGTAAATACTATGACAACCCTGAACCATA
AGCATTCAAATCATGGTCCCTGACTTGGGTAACTTTTTCAGGAGTTTGTTGGCTGGTCCTTGACTCAAATTAATTGAAAGCTAGACGAATGTAATGACACTTGCTTAACACAGCAAACAT
TGCTTCTTTGAATGTGAGCTGACGGTAGAGACAACATTTATTGTATTGATGATACTTGCTCTCTTGAAATCTATTATGGTAGGTAAACACGTCAGGTTTGGGTTGGAATATTTATTGGTG
ATAGGTTAGGGCAAAAGTTCAAAGGAGTTGCAAACTTCAATCCATCAGATGTAAGGTATCAAAATTTTGGTGTCCTACTCAAATGTGACCCCGAAATATTGTCTCTGGGGTAACATGTCC
GTCCTATGACATGTTAGCTTTGTTGGGAAAAACCTCAATTGATAGCTATTGTTATGTCCATCAATTCTAGATTTGCCTTTTTTTTTTCATTCTGGTTTTCAGATTGGCATCACTTGACTG
CTATAGAATTTTCCTTCTTATTTTGCTCTATTTGTGATTATACTTGTTGACAATCTCTCTCATGTGCACCTATTATATATGTGATCTGTTAATAGGTATGTAGCTTTGATAGTGCTGAAT
CATCTAGTTGCCTGACAACAGTTACTGCATCCAATTAGCCAATGTGTTAAGTTGCTGTTTGATTCTAGGTGTACGAGTCAATGGACCAGACACAGCACCAGTCTATAAGTTCCTCAAAGC
NAGTAAATCAGGATTTTTGGGTTCAGGAATAAAATGGAACTTCACGAAGTTCCTCGTTGATAAGGAGGGGCATGTCATCAGTCGCTATGGCACAACCACCTCTCCTTTAGCCATTGAG
GT
ACTCTTTCTTTCTCTCTTCACATAGATTCCCAGTTAGCAGATCATCTGCACACGTGCTTTTAGATCATTTTTCCTGGAAGAGAATTTATCACAGCCCCGTGACAAATAATACACGTAACG
CAGGNGNGGAGATAAAGAAGGCACTGGGGGAGGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGCGCTTCGCAGTCGGTCCCCGAGAAATCAATCCACGAGTTCANCGTCAAGGACAGTAGAGGGAAGGACGTTGACTTGAGTGCGTACAAAGGGAAGGTCCTCCTCGTTGTTAACGTT
GCCTCCAAATG
TGGATTCACGAATTCCAACTATACACAGCTCACTGAACTTTACAACAAATACAAAGACCAAGGTCTTGAGATCTTGGCTTTTCCGTGCAACCAATTTTTGAAACAAGAA
CCTGGAACAAGTCAGGAGACACAAGAATTTGCATGTACAAGATTCAAAGCTGAATACCCGATCTTCCACAAG
GTACGAGTCAATGGACCAGACACAGCACCAGTCTATAAGTTCCTCAAA
GCNAGTAAATCAGGATTTTTGGGTTCAGGAATAAAATGGAACTTCACGAAGTTCCTCGTTGATAAGGAGGGGCATGTCATCAGTCGCTATGGCACAACCACCTCTCCTTTAGCCATTGAG
GNGGAGATAAAGAAGGCACTGGGGGAGGCATGA

Retrieve as FASTA