Entry information : OsPrx130(LOC_Os11g02130)
Entry ID 1140
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Catherine
Last annotation changes 2022-01-25 (Catherine )
Peroxidase information: OsPrx130(LOC_Os11g02130)
Name OsPrx130(LOC_Os11g02130)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Callus
Leaves
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx130
start..stop
S start..stop
OsPrx135 608 0 1..324 1..327
SbPrx83 563 0 24..324 31..331
SbPrx84 563 0 22..324 26..328
SpPrx08 562 0 22..324 27..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 582210..582434 225 N° 2 582521..582712 192 N° 3 582785..582950 166 N° 4 584013..584404 392
join(582210..582434,582521..582712,582785..582950,584013..584404)


exon

Literature and cross-references OsPrx130(LOC_Os11g02130)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1G3
DNA ref. GenBank:   NC_008404.1 (582210..584401)
EST ref. GenBank:   CI189311.1 [3' end]
Cluster/Prediction ref. UniGene:   Os.73656
Protein sequence: OsPrx130(LOC_Os11g02130)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (296)
PWM (Da):   %s   34011.82 (31340.4) Transmb domain:   %s   i12-34o
PI (pH):   %s   7.26 (6.87) Peptide Signal:   %s   cut: 29 range:29-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQPTSSARCSLVVMVVVVLAVAGGSSAQLSPSFYSYSCPGVFDAVKCGMQSAIANEKRIGASIVRLFFHDCFVQGCDASLLLDDTASFTGEKMANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGPSWDVKVGRRDSRTASLSGANNNIPPPTSGLANLTSLFAAQGLSQKDMVALSGSHTIGQARCTNFRAHIYNETNIDSGFAMSRQSGCPRSSGSGDNNLAPLDLQTPTVFENNYYKNLVVKKGLLHSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGEIRKNCRRIN

Retrieve as FASTA  
Remarks chromosome 11. 11 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAGCCAACTTCGTCAGCAAGGTGTTCCCTCGTCGTGATGGTGGTGGTGGTGCTCGCGGTCGCCGGCGGGTCGTCGGCGCAGCTGTCGCCGAGCTTCTACTCATACTCGTGCCCG
GGAGTGTTCGACGCAGTCAAGTGCGGGATGCAGTCCGCCATCGCCAATGAGAAGCGTATCGGCGCCTCCATCGTCCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GTAACTGTTTGACCA
TCGATCGATCATGGTACGTGTTGGGCTAACCATTCTTGCAGCGACTGATCGATGACCATAAGCACGTGTAGGGTTGCGACGCATCGCTGCTGCTGGACGACACGGCGAGCTTCACCGGCG
AGAAGATGGCGAACCCCAACAACGGCTCCGTCAGAGGGTTCGAGGTGATCGACGCCATCAAGTCGGCGGTGGAGACCATCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATCG
CTGCCAGGGACAGCGTCGCCATC
GTACGTCCACCTACTTCGATCTCTATGTTGCAACTGAAACTGAAACTGAAAATGGTACATATGTATATGCAGCTGGGTGGGCCGAGCTGGGACGTGA
AGGTTGGTCGGAGAGACTCGCGCACGGCGAGCCTCAGCGGAGCAAACAACAACATCCCGCCGCCGACGTCGGGACTCGCCAACCTCACCTCCCTCTTCGCCGCGCAGGGCCTCTCCCAGA
AAGACATGGTCGCCCTCTCCG
GTAACCACTGCTAGTGCTAGCTAGCTAGCTGTTACTAGTACTTTTGTTTCCACTGAGCATTCAATTAAGTCTAGCTTGTTAACTAACAAAAAATAAAAT
TTACTAAAAATGCAAGCATCAATTCATTCACATGACAAAATCAACAAGCATCGACAACTGTTCCATCTTTCAATCCCTTCTAGAAGGGAAAAGGAAAAAGGTTCGGAACAACTTCATTTC
ACACTCTGTTTCTGTTTCTGAATAGTATCAGTAGCTTTTGTGTCAATCTGCACACAGCTGGGTACCACGCAAACGGAACAGATTGCTACGTTTTCAATTTGCAGCATACTTGGCATTCTC
CAAGCCTATACTACTTTGACAAGATGATTAATTTACGAAAGTCTGGATAAACATCTCAGATTCAACTAGCAGTATAACCTCTGACTCTGAGTTCCCACTTGTCTCCCCTGTTTATTTTTT
TTTAAGAAAAAGAAAGAATCAGTGTCATCTGTTTAACATGCAATTTGTTAACTTACTTGTTAACCAAACAAAACGTAGTAGCAAAGTCGGTAAGCATGGTTGTCGATGGGATGGCATAAA
GTTAATTTGAGGTAATGACGTACTCCTAACCGTGTCTGCGTTGTCGGTATGGGTTAATTTGCTTCTGAAGAAATAGTACAGGCTTTTCTTTTTAAGGTTAGTAATCAGTACAGACTGCTG
CCAATCGAAAAGATCAGTCTGCCATCACATGCCGTGAATTGGCTAAATTACAAAAGCAAAAATTAATTTATTTCCTAAAAACCCAAAAGCAAGAATAAAGTTGATAAACCCTGGCTACCC
ATCAAGTTAATTACAACCACAGATAATGTTCCTTTTGTTCTGTTTGTTAATAATGTGTTCCAATAATGTTGATTTTTTTTCTTTATTCCAATTAAAATTAGGGAATGGTGAAGAACCTAT
ACTTTCTTTCTAAAACAAAAATATTGACAATATTATACAAAAGCAAAGACCTAAAAGCTCAGCTCTTAAATATTCTAAATTATTCTAAACTAAGTATAGCATGATTTCATATTGTACCTG
CAGGATCTCACACCATTGGACAAGCACGATGCACAAACTTCAGAGCTCACATATACAACGAAACCAACATCGACAGTGGCTTTGCGATGAGCAGGCAATCAGGCTGCCCTCGTAGCTCAG
GCTCAGGTGACAACAATCTGGCACCTTTGGATCTTCAGACGCCAACCGTGTTCGAGAACAACTACTACAAGAACCTCGTCGTCAAGAAGGGGCTCCTGCACTCTGATCAGGAGCTCTTCA
ATGGCGGAGCTACTGATGCTCTGGTTCAGTCTTACATTAGTAGCCAGAGCACATTCTTTGCTGATTTTGTGACGGGCATGATCAAGATGGGGGACATCACACCGTTGACGGGATCAAACG
GGGAGATCAGGAAGAACTGCAGAAGGATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAGCCAACTTCGTCAGCAAGGTGTTCCCTCGTCGTGATGGTGGTGGTGGTGCTCGCGGTCGCCGGCGGGTCGTCGGCGCAGCTGTCGCCGAGCTTCTACTCATACTCGTGCCCG
GGAGTGTTCGACGCAGTCAAGTGCGGGATGCAGTCCGCCATCGCCAATGAGAAGCGTATCGGCGCCTCCATCGTCCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GGTTGCGACGCATCG
CTGCTGCTGGACGACACGGCGAGCTTCACCGGCGAGAAGATGGCGAACCCCAACAACGGCTCCGTCAGAGGGTTCGAGGTGATCGACGCCATCAAGTCGGCGGTGGAGACCATCTGCCCC
GGCGTCGTCTCCTGCGCCGACATCCTCGCCATCGCTGCCAGGGACAGCGTCGCCATC
CTGGGTGGGCCGAGCTGGGACGTGAAGGTTGGTCGGAGAGACTCGCGCACGGCGAGCCTCAGC
GGAGCAAACAACAACATCCCGCCGCCGACGTCGGGACTCGCCAACCTCACCTCCCTCTTCGCCGCGCAGGGCCTCTCCCAGAAAGACATGGTCGCCCTCTCCG
GATCTCACACCATTGGA
CAAGCACGATGCACAAACTTCAGAGCTCACATATACAACGAAACCAACATCGACAGTGGCTTTGCGATGAGCAGGCAATCAGGCTGCCCTCGTAGCTCAGGCTCAGGTGACAACAATCTG
GCACCTTTGGATCTTCAGACGCCAACCGTGTTCGAGAACAACTACTACAAGAACCTCGTCGTCAAGAAGGGGCTCCTGCACTCTGATCAGGAGCTCTTCAATGGCGGAGCTACTGATGCT
CTGGTTCAGTCTTACATTAGTAGCCAGAGCACATTCTTTGCTGATTTTGTGACGGGCATGATCAAGATGGGGGACATCACACCGTTGACGGGATCAAACGGGGAGATCAGGAAGAACTGC
AGAAGGATTAATTAA

Retrieve as FASTA