Entry information : EguPrx02
Entry ID 11411
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2014-03-26 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-26 (Christophe Dunand)
Peroxidase information: EguPrx02
Name EguPrx02
Class Class III peroxidase    [Orthogroup: Prx064]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx02
start..stop
S start..stop
EcamPrx15 682 0 1..330 5..334
EgrPrx02 682 0 1..330 1..330
EgrPrx15 681 0 1..330 5..334
EglPrx15 633 0 1..329 5..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8782..9015 234 N° 2 9210..9395 186 N° 3 9558..9717 160 N° 4 9973..10385 413
join(8782..9015,9210..9395,9558..9717,9973..10385)


exon

Literature and cross-references EguPrx02
Protein sequence: EguPrx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (312)
PWM (Da):   %s   36676.75 (34591.7)  
PI (pH):   %s   7.34 (7.36) Peptide Signal:   %s   cut: 19 range:19-330
Sequence 371
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWWQLLLSALALLRSCEAQPIEAKATIKLPPPLQWHFYQNSCPDVEKYVRDQVEFYWKQDSTLAPKLIQLLYTDCFIKGCDASVLLxGPDAEKTAPQNAAILGFPLEVIDKVKEVLEQHCPGVVSCADIINLAARDAVVLAGGVSYPVPTGRRDGNSSNAKLVDLPKRAVPWEKVIPYFKIRGLDLFDVTTLLGGHTLGRTSCEFIAERLYEFNNTGKPDPSMDPSFLAELRVQCPPNSTNSVYLNPDSGSSNRFSKTFYSRVLNHRAVLSIDQQIAAHKESLQIARRYDANFEDFLKMFGYSMTKLGNTWLLPGDQGEIRKNCRVVNGK

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Containing motif YTDC instead of FHDC.
scaffold_1_269 (8782..10385)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTGGTGGCAGCTGTTGCTATCGGCGCTCGCGTTGTTGCGCTCGTGCGAGGCACAGCCCATCGAGGCCAAGGCTACGATCAAGCTGCCGCCGCCGCTGCAGTGGCATTTCTACCAGAACT
CGTGCCCCGACGTCGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCTCCCAAGCTCATCCAACTTCTCTACACTGACTGCTTCATCAAG
GCACGTA
CCGTCTGTTCATTTCCTTCTTTCTGTCTCTCTCGCGATCTTGAAGTCGGCATCACTTTAATCATCGAGTTTCCGTTGCCCTATCTAAGCATGCCAAATCCTTTCACCCGTTGGTTTAACT
TCTCGAACTGGGCTTTCTAATATACCACTCTTCTGTGTACGTATGTATGGTTATGTGGATAAAACAGGGATGCGATGCGTCGGTTCTCTTGGANGGGCCAGATGCAGAGAAAACAGCACC
ACAAAATGCAGCGATTCTAGGGTTTCCTCTGGAGGTGATTGACAAGGTCAAGGAAGTCCTGGAACAGCATTGTCCCGGGGTCGTCTCTTGCGCCGACATTATCAACCTTGCCGCTAGAGA
TGCTGTCGTCTTG
GTATGCAGCATGGTTCTNAGTTTTTCCTTTTTGAGCTGGAAANGAGATTGTTTGGGCTGCTGCACTGATGATAATCGACGTGCTGTTAGCTTGAGTTTTGGAGCGTT
CGATATGGAAAGGAAAAAAATTAGAATTACTAATGTGATAATGATGTTGTAATAGGCTGGAGGGGTGTCGTACCCTGTTCCGACGGGGAGGAGGGACGGAAATTCGTCCAATGCGAAGTT
GGTGGACCTCCCAAAGCGCGCCGTCCCGTGGGAAAAGGTGATCCCTTACTTCAAAATAAGGGGCTTGGATTTGTTCGACGTCACTACTCTACTTG
GTACGGTCTAACCCTCGAATGAAAA
GTGTTTATTTGACTCCGACCTCATTACATTACCCTAAGATCTTAACCAATCCAGGCAACTCATTTAGTTCAGTGAATCACGCTGTCCCTTCTAGCTTTCATGTGATCCGAACCAATCCTC
CCAATGATCTCCTACAAGTGCACAAAAATGGCATGCTCACGTATCATGTCGAACTCTCAATCATAACCAATTCCTCCTAACTTTTCCAAAAACAACTTAAATTTTGCCAGGGGGGCATAC
ACTGGGCAGGACCAGCTGCGAGTTCATCGCAGAAAGACTGTACGAGTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGGTGCAATGCCCGCC
AAACTCAACGAATTCAGTGTACCTAAATCCTGACTCAGGCTCGAGTAACAGGTTCAGCAAAACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCGACCAGCAGATCGC
CGCCCATAAGGAGAGCCTCCAGATTGCCCGGCGATACGATGCCAATTTTGAGGACTTCCTGAAGATGTTCGGCTATTCAATGACCAAGCTGGGGAACACCTGGCTCCTACCAGGGGATCA
GGGTGAGATTCGCAAGAATTGCCGAGTCGTGAACGGGAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTGGTGGCAGCTGTTGCTATCGGCGCTCGCGTTGTTGCGCTCGTGCGAGGCACAGCCCATCGAGGCCAAGGCTACGATCAAGCTGCCGCCGCCGCTGCAGTGGCATTTCTACCAGAACT
CGTGCCCCGACGTCGAGAAGTACGTGAGGGACCAGGTCGAGTTCTACTGGAAGCAGGACAGCACCCTCGCTCCCAAGCTCATCCAACTTCTCTACACTGACTGCTTCATCAAG
GGATGCG
ATGCGTCGGTTCTCTTGGANGGGCCAGATGCAGAGAAAACAGCACCACAAAATGCAGCGATTCTAGGGTTTCCTCTGGAGGTGATTGACAAGGTCAAGGAAGTCCTGGAACAGCATTGTC
CCGGGGTCGTCTCTTGCGCCGACATTATCAACCTTGCCGCTAGAGATGCTGTCGTCTTG
GCTGGAGGGGTGTCGTACCCTGTTCCGACGGGGAGGAGGGACGGAAATTCGTCCAATGCGA
AGTTGGTGGACCTCCCAAAGCGCGCCGTCCCGTGGGAAAAGGTGATCCCTTACTTCAAAATAAGGGGCTTGGATTTGTTCGACGTCACTACTCTACTTG
GGGGGCATACACTGGGCAGGA
CCAGCTGCGAGTTCATCGCAGAAAGACTGTACGAGTTCAACAACACTGGCAAGCCAGACCCAAGCATGGACCCATCCTTCTTGGCCGAATTGAGGGTGCAATGCCCGCCAAACTCAACGA
ATTCAGTGTACCTAAATCCTGACTCAGGCTCGAGTAACAGGTTCAGCAAAACCTTCTACTCCAGGGTCCTGAACCACCGGGCCGTCCTCAGCATCGACCAGCAGATCGCCGCCCATAAGG
AGAGCCTCCAGATTGCCCGGCGATACGATGCCAATTTTGAGGACTTCCTGAAGATGTTCGGCTATTCAATGACCAAGCTGGGGAACACCTGGCTCCTACCAGGGGATCAGGGTGAGATTC
GCAAGAATTGCCGAGTCGTGAACGGGAAATAA

Retrieve as FASTA