Entry information : OsPrx134 (LOC_Os11g43980)
Entry ID 1144
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2014-01-08 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-28 (Christophe Dunand)
Peroxidase information: OsPrx134 (LOC_Os11g43980)
Name (synonym) OsPrx134 (LOC_Os11g43980)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx134
start..stop
S start..stop
SbPrx24 500 3.73e-180 9..335 14..336
TaPrx47-1D 499 1.94e-179 28..335 29..336
TaPrx47-1B 495 6.03e-178 28..335 29..336
SiPrx85 491 1.82e-176 30..335 30..331
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '1144' 'join(1..228,744..1524)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..228 226 N° 2 744..1524 779  
join(1..228,744..1524)


exon

Literature and cross-references OsPrx134 (LOC_Os11g43980)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1F9
DNA ref. GenBank:   55701134
Protein sequence: OsPrx134 (LOC_Os11g43980)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   335 (306)
PWM (Da):   %s   35601.84 (32747.5) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.94 (7.99) Peptide Signal:   %s   cut: 30 range:30-335
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSPTMLVVMCSSLAMAVILSSSSPAMAQLDVGFYSKTCPKVEEIVREEMIRILAVAPTLAGPLLRLHFHDCFVRGCDGSVLIDSTASNTAEKDAPPNQTLRGFGSVQRIKARLDAACP
GTVSCADVLALMARDAVALSGGPRWAVPLGRRDGRVSAANDTTTQLPPPTANITQLARMFAAKGLDMKDLVVLSGGHTLGTAHCSAFTDRLYNFTGANNAGDVDPALDRSYLARLRSRCA
SLAGDNTTLAEMDPGSFLTFDAGYYRLVARRRGLFHSDSSLLDDAFTAGYVRRQATGMYAAEFFRDFAESMVKMGGVGVLTGGEGEIRKKCYVIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 11, intron1) and 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGTCTCCGACGATGTTGGTGGTGATGTGTAGTAGCTTGGCCATGGCGGTGATCCTGTCGTCGAGCTCGCCGGCGATGGCGCAGCTGGACGTGGGGTTCTACAGCAAGACGTGC
CCCAAGGTGGAGGAGATCGTGCGGGAGGAGATGATCAGGATCCTCGCCGTCGCCCCCACCCTCGCCGGCCCTCTCCTCCGCCTCCATTTCCACGACTGCTTCGTCAGG
GGGTAAGCACAT
TGATCATACTGTTCTTGGTGTGCATGCAAAAATGAAGAAGATGTGCTAGAATCTATGTGATTTTGAAACATTTTCTTAATAAGTTGAACTTGTTTAGAGAGAGTTGAGAGGGTTAGTTTG
TCCCAACACCCATCACCTTAAATTATGGCTTTATTTTTAGATACCAAAACTTATTGACTATATGTCTTATACCCCGTTTCAGATTATAAGTTGTTGTAGAAAAAAATAGTTATATTTTCA
ACCCAACACAAATATATTAAAAAATATTTAATTATAGATTTAATGAAACTAATTTGTTGTTATAAATATTAATATATTTGTGTATAAACTTGATAAAATTTAGAGTAGTTTAACTTTAAC
CAAAGTAAAAACGACTTATAATCTAAAACAGTGGTAGTATATAGTAGTCGGCGAAGATGTAAATCATTTTTATTATGTAAAAATAATGTCAGAGACTTTTCCAACATTTTTGCTGGATTC
GAACATTATTTTCATTGATAATGCAGGGTTGCGACGGGTCGGTGCTGATCGACTCGACGGCGAGCAACACGGCGGAGAAGGACGCGCCGCCGAACCAGACGCTGCGAGGGTTCGGCTCCG
TGCAGCGGATCAAGGCGAGGCTCGACGCCGCCTGCCCGGGCACCGTCTCCTGCGCCGACGTGCTCGCGCTCATGGCCCGCGACGCCGTCGCCCTCTCCGGCGGCCCCCGCTGGGCCGTGC
CCCTCGGCCGGCGAGACGGCCGCGTCTCCGCCGCCAACGATACCACCACCCAGCTGCCGCCGCCCACCGCCAACATCACGCAGCTCGCCCGGATGTTCGCCGCCAAGGGCCTCGACATGA
AAGACCTCGTCGTGCTCTCCGGCGGCCACACGCTCGGCACGGCGCACTGCTCGGCGTTCACGGACAGGCTCTACAACTTCACCGGCGCCAACAACGCCGGCGATGTCGACCCCGCCTTGG
ACCGGAGTTATCTAGCGCGGCTCCGGTCGCGGTGCGCCAGCCTCGCCGGCGACAACACGACGCTGGCGGAGATGGACCCCGGGAGCTTCCTCACCTTCGACGCCGGCTACTACCGGCTGG
TGGCGAGGCGGCGGGGGCTCTTCCACTCCGACTCGTCGCTGCTAGACGACGCGTTCACCGCCGGCTACGTGCGGCGGCAGGCCACCGGCATGTACGCCGCCGAGTTCTTCAGGGATTTTG
CCGAGTCGATGGTCAAGATGGGCGGCGTCGGCGTGCTCACCGGCGGCGAAGGCGAGATCAGGAAGAAGTGCTACGTCATCAACTAA

Retrieve as FASTA