Entry information : EguPrx132(g4844.t1)
Entry ID 11443
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2023-04-20 (Christophe Dunand)
Peroxidase information: EguPrx132(g4844.t1)
Name EguPrx132(g4844.t1)
Class Class III peroxidase     [Orthogroup: Prx020]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx132
start..stop
S start..stop
EgrPrx132 648 0 1..330 1..329
EcamPrx132 630 0 1..330 1..333
EglPrx132 532 0 16..330 15..329
PvPrx17 517 0 14..330 19..335
Gene structure Fichier Exons


exon

Literature and cross-references EguPrx132(g4844.t1)
Protein sequence: EguPrx132(g4844.t1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (309)
PWM (Da):   %s   35730.67 (33404.4) Transmb domain:   %s   i21-43o
PI (pH):   %s   4.56 (4.55) Peptide Signal:   %s   cut: 22 range:22-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSPDLSVLFLLLLLLRQTAMAVALQPGYYAETCPGAEAAVREAMKVALIREPRSVASVMRFQFHDCFVNGCDGSLLLDDTPTMVGEKEAxSNINSLRSFEVxDEAKDALEKACPGIVSCA
DVVIMAARDAVALTGGPDWEVKLGRMDSLTACQEDSNDIMPSPRANASFLIDLFAGYGLSVKDLVALSGSHSIGQARCFSIMFRLYNQSGTGRPDPAIDPGFLDELxKLCPQGVDQNVTG
NLDSTPRVFDNQYFKDLVAGRGFLNSDQTLFTFPQTRAYVRRFSLDQDEFFRAFLEGMIKMGDLMSDRPGEIRRNCRVVNSRPVDGLSES

Retrieve as FASTA  
Remarks Complete sequence from genomic (Short 5' end is missing). No EST. Scaffold_8_30333 (23385..21741).
Paternal (g4844.t1, partial exon 4 ismissing): DTPTMVGEKEAL, SNINSLRSFEVI
DNA
Send to BLAST
CDS
Send to BLAST