Entry information : OsPrx135(LOC_Os12g02080)
Entry ID 1145
Creation 2006-07-26 (Filippo Passardi)
Last sequence changes 2006-07-26 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-02-10 (Christophe Dunand)
Peroxidase information: OsPrx135(LOC_Os12g02080)
Name OsPrx135(LOC_Os12g02080)
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsPrx135
start..stop
S start..stop
OsPrx130 610 0 1..327 1..324
SbPrx83 554 0 27..327 31..331
SbPrx84 553 0 25..327 26..328
SpPrx08 553 0 25..327 27..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 622704..622937 234 N° 2 623022..623213 192 N° 3 623285..623450 166 N° 4 624510..624901 392
join(622704..622937,623022..623213,623285..623450,624510..624901)


exon

Literature and cross-references OsPrx135(LOC_Os12g02080)
Literature Passardi F., Longet, D., Penel C. and Dunand, C. The class III peroxidase multigenic family in rice and its evolution in land plants Phytochemistry, 65 (13), 1879-1893 (2004)
Protein ref. UniProtKB:   Q5U1F8
DNA ref. GenBank:   NC_008405.1 (622704..624898)
EST ref. GenBank:   CT845111.1 [5' end]   CI190014.1 [3' end]
Cluster/Prediction ref. UniGene:   Os.11549
Protein sequence: OsPrx135(LOC_Os12g02080)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (296)
PWM (Da):   %s   34692.44 (31514.7) Transmb domain:   %s   i12-34o
PI (pH):   %s   8.57 (8.20) Peptide Signal:   %s   cut: 32 range:32-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAQPTWSARRVTAALVVMVVVVLAVAGGSWAQLSPSFYSYSCPGVFNAVKRGMQSAIAREKRIGASIVRLFFHDCFVQGCDASLLLDDTASFTGEKTANPNNGSVRGFEVIDAIKSAVETICPGVVSCADILAIAARDSVAILGGPSWDVKVGRRDSRTASLSGANNNIPPPTSGLANLTSLFAAQALSQKDMVALSGSHTIGQARCTNFRAHIYNETNIDSGFAMRRQSGCPRNSGSGDNNLAPLDLQTPTVFENNYYKNLVVKKGLLHSDQELFNGGATDALVQSYISSQSTFFADFVTGMIKMGDITPLTGSNGEIRKNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 12, 3 introns) and 31 ESTs. Unigene also contains ESTs from OsPrx130.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAGCCGACTTGGTCAGCAAGGCGCGTCACTGCCGCCCTGGTCGTGATGGTGGTGGTGGTGCTCGCGGTCGCCGGCGGGTCGTGGGCGCAGCTGTCGCCGAGCTTCTACTCGTAC
TCGTGCCCGGGAGTGTTCAACGCGGTGAAGCGGGGGATGCAGTCGGCCATCGCCAGGGAGAAGCGCATCGGCGCCTCCATCGTCCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GTAACC
ATCCTCTACCTAGTACAAGTATACGCACGCACACATTGATCATGCTATATAATTAATCTGTGCATGTATGAATGCCAGGGTTGCGACGCATCGCTGCTGCTGGACGACACGGCGAGCTTC
ACCGGCGAGAAGACGGCGAACCCCAACAACGGCTCCGTCAGAGGGTTTGAGGTGATCGACGCCATCAAGTCGGCGGTGGAGACCATCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTC
GCCATCGCTGCCAGGGACAGCGTCGCCATC
GTACGTACTCCACTTCGATCGATCGATCTCTATATACTGAAACTGAAACTGAAAATGGTACATATATGCAGCTGGGTGGGCCGAGCTGGG
ACGTGAAGGTTGGTCGGAGAGACTCGCGCACGGCGAGCCTCAGCGGCGCAAACAACAACATCCCGCCGCCGACGTCGGGACTCGCCAACCTCACCTCCCTCTTCGCCGCGCAGGCCCTCT
CCCAGAAGGACATGGTCGCCCTCTCCG
GTAACCACTGCTAGCTGTTACTAGTATTTTTGTTTCCACTGAGCATTCAATTAAGTCTAGCTTGTTAACTAACAAAAATAAAAATTTATAAAT
GCAAGCATCAATTCATTCACATAACTAAACGAACAAGCATCGTCAACTGTTCCATTTTTCAATCCCTTCTAGAAGGGAAAAGGAAAAAGGGTTCGGAACAACTTCATTTCACACTCTGTT
TCTGAATAGTATCAGTAGCTTTTGTGTCGATCTGCACACAGCTGGGTACCACGCAAACGGAACAGATAGCTACGTTTTCAATTTGCAGCATACTTGGCATTCTCCAAGCCTATACTACTT
TGACAAGATGATTAATTTACGAAAGTCTGCATAAACATCTCAGATTCAACTAGCAGTATAACCTCTGACTCTGAGTCCCCACTTGTCTCCCCTGTTTATTTTTTTTAAGAAAAAGAAAGA
TTCAGTGTCATCTGTTTAACATGCAATTTGTTAACTTACTTGTTAACCAAACAAAACGTAGTAGCAAAGTCGGTAAGCATGGTTGTCGATGGGATGGCATAAAGTTACTTTGAGGTAATG
ACGTACTCCTAACCGTGTCTGCGTTGTCGGTATGGGTTAATTTGCTTCTGAAGAAATAGTACAGGCTTTTCTTTTTAAGGTTCAGTAATCAGTACAGACTGCTGCCGATCGAAAAGATCA
GTCTGCCATCACATGCCGTGAATTGGCTAAATCACAAAAGCAAAAATTAATTTGTTTCCTAAAAAACCAAAAGCAAGAATAAAGTTGATAAACCCTGGCTACCCATCAAGTTATTAATTA
CAACCACAGATAATGTTCCTTTTGTTCTGTTTGTTAATAAATGTGATCGAATAATGTTGATTTTTTTTCTGTATTCCAATTAATATTAGGGAATGATGAAGAACCTATACTTTCTTTCTA
AAATAAAAATATTCACAATACTATACAAAAGCAAAGACCTAAAAGCTCAGCTCTTAAATATTCTAAATTATTCTTACACATATGCTCAGCTCTTAAGTATAGCATGATTTCATATTGTAC
CTGCAGGATCTCACACCATTGGGCAAGCACGATGCACAAACTTCAGAGCTCATATATACAACGAAACCAACATCGACAGTGGCTTTGCGATGAGGAGGCAATCAGGTTGCCCTCGTAACT
CAGGATCAGGTGACAATAACCTGGCACCTCTGGATCTTCAGACGCCAACCGTGTTCGAGAACAACTACTACAAGAACCTCGTCGTCAAGAAGGGGCTCCTGCATTCTGATCAGGAGCTCT
TCAATGGCGGAGCCACTGATGCTCTTGTTCAGTCTTACATAAGTAGCCAGAGCACATTCTTTGCGGATTTTGTGACGGGCATGATCAAGATGGGGGACATCACACCGTTGACGGGATCAA
ACGGGGAGATCAGGAAGAACTGCAGAAGGATTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTCAGCCGACTTGGTCAGCAAGGCGCGTCACTGCCGCCCTGGTCGTGATGGTGGTGGTGGTGCTCGCGGTCGCCGGCGGGTCGTGGGCGCAGCTGTCGCCGAGCTTCTACTCGTAC
TCGTGCCCGGGAGTGTTCAACGCGGTGAAGCGGGGGATGCAGTCGGCCATCGCCAGGGAGAAGCGCATCGGCGCCTCCATCGTCCGCCTCTTCTTCCACGACTGCTTCGTCCAA
GGTTGC
GACGCATCGCTGCTGCTGGACGACACGGCGAGCTTCACCGGCGAGAAGACGGCGAACCCCAACAACGGCTCCGTCAGAGGGTTTGAGGTGATCGACGCCATCAAGTCGGCGGTGGAGACC
ATCTGCCCCGGCGTCGTCTCCTGCGCCGACATCCTCGCCATCGCTGCCAGGGACAGCGTCGCCATC
CTGGGTGGGCCGAGCTGGGACGTGAAGGTTGGTCGGAGAGACTCGCGCACGGCG
AGCCTCAGCGGCGCAAACAACAACATCCCGCCGCCGACGTCGGGACTCGCCAACCTCACCTCCCTCTTCGCCGCGCAGGCCCTCTCCCAGAAGGACATGGTCGCCCTCTCCG
GATCTCAC
ACCATTGGGCAAGCACGATGCACAAACTTCAGAGCTCATATATACAACGAAACCAACATCGACAGTGGCTTTGCGATGAGGAGGCAATCAGGTTGCCCTCGTAACTCAGGATCAGGTGAC
AATAACCTGGCACCTCTGGATCTTCAGACGCCAACCGTGTTCGAGAACAACTACTACAAGAACCTCGTCGTCAAGAAGGGGCTCCTGCATTCTGATCAGGAGCTCTTCAATGGCGGAGCC
ACTGATGCTCTTGTTCAGTCTTACATAAGTAGCCAGAGCACATTCTTTGCGGATTTTGTGACGGGCATGATCAAGATGGGGGACATCACACCGTTGACGGGATCAAACGGGGAGATCAGG
AAGAACTGCAGAAGGATTAATTAA

Retrieve as FASTA