Entry information : EguPrx[P]139
Entry ID 11450
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-22 (Christophe Dunand)
Peroxidase information: EguPrx[P]139
Name EguPrx[P]139
Class Class III peroxidase     [Orthogroup: Prx005]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]139
start..stop
S start..stop
EgrPrx[P]139 372 6e-132 1..233 24..298
EglPrx[P]139 364 5e-130 1..233 1..214
EguPrx[P]140 228 5e-77 117..233 25..141
EcamPrx179 224 7e-76 117..233 4..120
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1026..1160 135 N° 2 1303..1526 224 N° 3 6798..7140 343  
join(1026..1160,1303..1526,6798..7140)


exon

Literature and cross-references EguPrx[P]139
Protein sequence: EguPrx[P]139
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   234
PWM (Da):   %s   24480.18  
PI (pH):   %s   7.34
Sequence 275
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
VQGRGTRVESYSGSCPxAEAIIRSTIQAHFxSDPTVAPGLFFFFFNPSPPPMHFHDRFIQGCDGSVLINGPxAEKTAPPNHLLRGYELINDAKTQLEAACPSVVSCADILALPACNSVALDASIDPSFVSQLQSLCPQNGDGTRRVALNTGSPSRFDASFFxNLRSGRGVLESDQKLWTDASTKTFVQGFLSGRGxTQLDFNTEFAKSMVKMSKIGVKTGTDGEIRKICSAINx

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic (5' end is missing). Scaffold_9_33183 (1026..7140)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCAAGGACGAGGTACGAGAGTAGAGTCCTACTCAGGTTCGTGTCCGCNTGCCGAGGCCATTATTAGGTCAACGATTCAAGCCCATTTCCNGTCCGATCCCACTGTGGCTCCTGGGCTGT
TTTTTTTTTTTTTT
TTTTGGTCGGTCCTACGCTAATCCTGCTCTAACACTCACTCTCAGACTTTTGCCCTGCCTTCTTGTAGGGCGTGAGAGTCGAAACCCACTCCTGAAATGAAATCGT
CCCCACCCCAATCCCCCCTGAGAAGGTGGGGATTTGAACCCCTCACCTCCCCCTATGCACTTTCATGATCGCTTCATCCAGGGATGTGACGGTTCGGTTCTCATCAATGGGCCCAANGCT
GAGAAAACGGCGCCTCCGAACCATTTGCTGAGAGGATATGAATTGATCAATGACGCGAAGACCCAGCTCGAAGCTGCGTGTCCTAGTGTCGTTTCATGTGCTGATATTCTTGCTCTTCCA
GCCTGTAATTCCGTTGCTCT
GTTATTTAATAGTCATGTGCTTCNATTTGTTAGAGNTCTCCNCTACAAGGTGCAAATCTCTGTGTGGATCAATTTCATTCACTTCCATGCAAATCTTGGG
CGAGGTCCATGATATATGTGAGGGTTCTGGACTGGACCTGGATTCCTTAATTTTCCGATAGATATAGTGATGCCCTTGATGCAAGGCCTAGTTTTGTTACTGGTTATCTACTAGCTGCAA
GGAGAATAACTAGTATCATTCAAGTATGCATATATTCCTCTTAGTTGCATACATTGGCAGTTGATGAGCATGATGGGAGAGTTGACTTGTATAAGACTAGGAGATTTAAGCCGTTTAAGC
AGATGCACAACACTTTTATTAGATAGCCAAATAAACTTTGGTAGCAACACTGAAGTTTAGCAAGACAGAAGTTAGGCCATGAAGACTAAGGACACGAATGATGTAGATTGATAACGTGAG
GAGTTGTAGATGAACCAATAACCATTAGGTTTTAACATGTGTGGTTGTTAGAGATCTTACCTTAGTTACAAATTTATCAGGTAAAGCTGAAGTCGTTTTTTCCACTCTCTATTTCTAGAC
TTTTAAATCTACCTGTTCAGGCTTCATGACTTTTGGGTTGAATTTCTGCTATGACTTACCATCAGGTTGAAAACACTATTGGAGAGTTAGGGTGCGTTTGTTTGCGTTTCTGTTTAAAAA
TTGTTCCAGGGAACAGAAATAGAAAAAAGTGTTTCTGTTCCTGGGAACAATTTCTGAACAAAAAAACGCGTTTGGTAAACTTGTTCCGGGAACAAAAAATAAATAGAAACACGTTTGGTA
AATTTGTATAATTTTTTTATTTCTTTTATTTTTTTCTTNTTTTTCCTTTTTTTCTTTTTTCTTTTTCCTTTTTTCTTTTTTCTTCTTTTGGCCGGTCGCCGGCCTCGGCCATGGCCGGCG
ACCGGCCGACGAGGGCCGGCGGCCTCGCCATAGCTGGGCGAGGGTCGGCCTCGCCTTGGCTGGGCGAGCTCGAGCTCGCCCAGATCCGGCGAGGCCGAGCTCGCCCAGCCCGACGCGCCG
ACATCTCGCCGGATCTGGGCGAGCTCGAGCTCGAGCTCGCCCAGCTACGGCGAGGCTCGGCCTCGCCGGGGGCCGGCGAGCCTCGCCGTGCCTGGGCGAGGCCGCCGGCCCTCGTCGGCC
GGTCGCCGGCCATGGCCGAGGCCGGCGACCGGCGAAAGAAAAAAGAAAGAAAATAAGAAGAAAAAGAAGAAAAATTTCAAAAGTGTTTCTGATTTGTGTTTCTTGTTTCTNTTTCTTTTT
TGTTCCTGGGAACAAAAGAACAAAAAAAACAGAAAAAGTGTTTAAAAACAAAAAAAAGAAATACAAACAAACGCAGCCTTATACTTTCGAGAAGTCAGTGCGACTGCGGGTGCTGTCACA
ATCACTTGCCTCATGGTCTGTCCATTGCTGTGTTCATGGCTTCGGCAATAGTCTCGTAGTATAATTTTACACGAGTTTTTGGTTTGGGCATTATATTGTATTGATAAAGACAAAGATGCC
ATTGGGCAAAGATGCCATTGGGCGTAAAAATCTCTTGGTCGTGGGTACATTTTTCTATTTCTTCACGAAAATATTTTTAATATCTTAACTTTTGGATTCATCTGTGTCAGGTTGCAAATC
TCGTTGGCTTTGTGATTGGACCATCTGGTATCAGTTGGTTAATTGCTCGATTCCTTCATAAAGAAGGTATATCCCAATGTTGCCACCTTTGCAAGAGCTAAACATGCATTGTCTGTAAAG
ATTGACTTTCTATTTTGGTGATAGTGCATCATTAACCATGTTACTCGATACATCTCCTAAGATTGATGCTCCAGTGCTCATTACATTTCAGCTCCATTTTTATCATCTAGAAATATGGTC
TCAAAGACAATCGATGCAGTCCTTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTGTTCCTTTTAAACTTTCAGG
CTGATATGGATCAAGTCTTTGAATAAGATAGATTGTCGATGTTATCAAAAGATTTCTTATGTGAAACTTTTGAAGCCTGCTGGTTGATAGCATAGGATAAATGGTGCAAGTTGTGCCTTT
GTCAAATAAGACATTCTTCAACCTGCCAGCCTCTCCAAGCTGTCCGCATGAAATGCAAAAGATTTAGGCAAAAGCTTTCTGCATGAGATACACAAGTTTAAGGCCAGTTGGACCATTACA
TATGTACTAGCTATCATTATTTCAGTTTTCCATTTTACACAGTAGTATTGGAGCAAGCTCCATTCTCGGTGAGCACTTCACAAGATCCAAGTCCGTTGATGCTTTGTTGATACTTAAGCC
AGTGCTAAATTGGTTTTGAGCTCATTTTTCCTCTCTATTGGCAATTAAAACTGTAACTAGAGTCTGGGAGGAGATGGATGGATGCTGCTCTAGTGGGCAAGCGGAGATCGTCAGCCGCTT
CTGATATCGCAGAGCTCTATTAGCATCTAAGAGATTCTGCCAAATTTGTCCTTTCATGTCACTATATATAGCATTTATTGGGGATTCTTGAACTTGAACGATTAGTTCTTGCTACTTGCG
GAGCTGTTATCTTTGTTTTCACCTGTCTTTTTTCCTTCTTATTCCCTCAATTTTGGANCTCCGGGCATTGATAGAGCATCCATCTTGCAGGATGCCTGTCCTTGATGGCATGTTTTTGAC
ATTCTATGTGGGGACCAAGGCAAGTTAGATATCAACTTATCTTTGCCATTAATTGGACAAAAGTGACCAGAGTGACNTATTTCCCTGTTTTGCAGCTCATGTTTNATATCCAGGATGCCA
AACGGAAAGGACGGTGAATCAGACACCATGATTTGAAAGGGTTGTACTCANTTGCACCACTGCACAGTAGGATTATTTAGCAATCGACCACGGAGAAGAGCATTGATGAAATTTCTGGAC
TTACTGACCTTGGCATCAGAGTTAACCTGGAAAGGCATTCCATTACGCCTCCCGGCACTCGGCGGTAGAGTCAGATTTGTTAGCCCTGTATGGACTGGTAACTCTTCAGTGCTCGTGAAA
GTTGGTGCTGCTGAGAGCTATTTTTGTATAACGTTGTTTTGTCCTAGTCAATTGGTTGTGATGTAACACATAGTTATCTATGCAATATAAATTAATCAGATACAGATGCACATGAAAATG
ATATCAGTCAGTTCGCTCTTTCAACATTTTTGAAATATCGAAATGAACGGGTAATAAGGCCATTTTTCTTTGTCGAAGTATTAAGGCCACTTATGAAGAATAGGAGTGTCTTTGATTTAT
AATCCCTGTACATTTACTTCAAATGTGCATTATTTTTACTCTTTTCGTGTCTACTATAAATTGGACAAGACATACTTAAATCCTTCATAGAGATAATATCTGAAAGAATAATACCTCAAG
TGTTAATACTTGGCACATATGGATATATAATTGCCAAATTTTTTAGAATTTACACTTAAGTGTCACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNC
AACTCCGGTATCTTTGTCCNCAAAACGGTGATGGCACGAGGCGTGTTGCCCTCGACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCTTTGCAAACTTGAGGAGCGGAAGGGGAGTTT
TGGAGTCTGATCAGAAGCTATGGACCGATGCCTCCACCAAAACCTTCGTGCAGGGCTTTCTAAGCGGNCANNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGTTTGCTAAATCGATGGTGA
AGATGAGTAACATTGGCGTGAAGACGGGGACCAATGGTGAAATTAGGAAAATATGCTCTGCCATTAATGCATGATTTAGATCATTAAAGATTATTGCATTTTGGTATTTCAGTGTTATCT
GTTGGAGTCCGCGTAAGCTGATTCGTGGTGCATTCTAATGAAAGAAGGGAACGTGTAGTACTTTATAATTATATAAAATTGATGGCTATCGTCTCAAAAATGAAAATCTTGACCATGAAT
TTCAAGATTTCTTATATTCTTGTTCTGGTGCCATTTGNTTTTTTATTCAAAACTAGATGTCGGTGGCTTATTTATTCTAGTAAATGTGTGACGATTGACATAATCTAAGGTTTTTAGTGG
TTTTAAAAAATGCATTTTATGATAAAACGTAACAAATCTTTATAGAATATAGTAACATATAGAAAATTATATTTTTGAATGTTTTGTATTTGATCATATTTTAACATCATAAATTCGCAA
GATTTGATATCTTTTCATTTACGTTCACAACTCTAAAAAGCGTCTTGCTAGGTGGTACAAAATCAATGACCTATCTTGTGCTCGACTTGGGTTCATTAATTTTTATTTTTATGAAATTGA
TTTATATTATTATAATGCCTTCATATAGAAAATTAAAATAGAGTAAAGTAATTTGACACAATTACGATATAATTAATAAAAAAACATGTATACACTTCGGTTGTTGGAAAATAATTCATT
ATATATAAGTTTTGATAACTTAATTTGTCTTTTTTTTTTCTCTTGTTATTCTGTACTTTATTTTGTTAGCCAACTATATATTTAATTATTAGGATCACCATTGTTATGTCAAGAAAATTT
CCATTTAAAGCTCTGTCACGCTTGTGATAGTGATGTGCGACTCATTTGCGACTTCCATGCCACTCGCATGCTTGTTCTGTAGCAACGTCAAAGATGCGAGGAACCCAATAGTGGAAGGAT
CTACATCGATGCGGCAAACACTAGTGTCATTCACTTTTCTAGAAACGCCCTGGAAAAAATGCAGATTCAACTAGTGGCATTTGCACTTTAATCACTACTGATATGCACCATGCGGACCGC
TGTCATAGGACCGCCACCCACAGCTCACCGGCCATCGCCCCCTCTCGTGGCCAATGGGCTGTGGGCGGCAATCTTGTGTCTGCGGCGGCGACGATTGGCGATCGTGCGCCGGTCGTGCGG
TGGTCGTGCGGCGTTCGTGCGACAATCGTGCGGCGGTCGTGCGGCGATCGTGCGATGGTCGTGCGGCAGTCGTGTGGTGACAGTCGGCGTAGATATAAATTTCTCATATGTCCATGTGCA
TCAAAAGGGATACACTAAGTTTCTTGCTTTTGACCAATACTTGATACAGGAGGGCACACCATAGGAACTGGAGCTTNCCAATTCTTCANCTACAGACTCTACAACTTCACCAATACTACG
TCAAGTGGAGCGGACGCTTCCATTGATCCTTCCTTTGTTTCTCAACTCCAGTCTCTGTGTCCGCAAAACGGTGATGGCACAAGGCGTGTTGCCCTCAACACCGGCAGCCCTAGTCGTTTC
GATGCATCCTTCTTCNCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCCGATCAGAAGCTNTGGACCGATGCCTCCACCAAAACCTTCGTGCAAGGCTTTCTAAGCGGCAGAGGCCNG
ACCCAGTTGGACTTCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAAGATTGGTGTGAAGACGGGCACCGATGGTGAAATTAGGAAAATATGCTCCGCCATTAATGNA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCAAGGACGAGGTACGAGAGTAGAGTCCTACTCAGGTTCGTGTCCGCNTGCCGAGGCCATTATTAGGTCAACGATTCAAGCCCATTTCCNGTCCGATCCCACTGTGGCTCCTGGGCTGT
TTTTTTTTTTTTTT
AACCCCTCACCTCCCCCTATGCACTTTCATGATCGCTTCATCCAGGGATGTGACGGTTCGGTTCTCATCAATGGGCCCAANGCTGAGAAAACGGCGCCTCCGAACC
ATTTGCTGAGAGGATATGAATTGATCAATGACGCGAAGACCCAGCTCGAAGCTGCGTGTCCTAGTGTCGTTTCATGTGCTGATATTCTTGCTCTTCCAGCCTGTAATTCCGTTGCTCT
GG
ACGCTTCCATTGATCCTTCCTTTGTTTCTCAACTCCAGTCTCTGTGTCCGCAAAACGGTGATGGCACAAGGCGTGTTGCCCTCAACACCGGCAGCCCTAGTCGTTTCGATGCATCCTTCT
TCNCAAACTTGAGGAGCGGAAGGGGAGTTTTGGAGTCCGATCAGAAGCTNTGGACCGATGCCTCCACCAAAACCTTCGTGCAAGGCTTTCTAAGCGGCAGAGGCCNGACCCAGTTGGACT
TCAACACGGAGTTTGCTAAATCGATGGTGAAGATGAGTAAGATTGGTGTGAAGACGGGCACCGATGGTGAAATTAGGAAAATATGCTCCGCCATTAATGNA

Retrieve as FASTA