Entry information : EguPrx163
Entry ID 11470
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx163
Name EguPrx163
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx163
start..stop
S start..stop
EgrPrx163 656 0 1..326 1..326
EcamPrx163 649 0 1..326 1..326
EglPrx163 647 0 1..326 1..326
EgrPrx161 625 0 1..326 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 6236..6457 222 N° 2 6889..7077 189 N° 3 7512..7677 166 N° 4 7789..8189 401
join(6236..6457,6889..7077,7512..7677,7789..8189)


exon

Literature and cross-references EguPrx163
Protein sequence: EguPrx163
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (300)
PWM (Da):   %s   34661.7 (31908.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.21 (9.22) Peptide Signal:   %s   cut: 27 range:27-326
Sequence 367
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAQKLLSLLVFQLALVAFILDVANAQGLKIGFYKNTCPQAEEIVKKAAASFISRAPSLAAPLLRMHFHDCFVRGCDGSVLLNSTSSNQAEKDAFPNLSLRGxQVIDAAKDALEKKCPGVVSCADILALVARDAVSMMNGPYWQVPTGRRDGRVSKLQDALNNLPAPTFxISALKSSFAxKGLSVKDLAVLSGGHTLGMSHCSSFTNRLYNFTGKNDADPSMDPNYVAQLKTKCKPNDATTIVEMDPGSAKTFDVDYYTLVSKRRGLFQSDAALLTDSTTNAYVQLQRTSKSTFAKDFGVSMVNMGNIGVLTGNSGEIRKKCYLVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Scaffold_11_36240 (6236..8189)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTGCTCAGAAGCTTCTCTCTCTCCTGGTTTTCCAGCTCGCGCTCGTCGCTTTTATTCTCGACGTCGCCAATGCTCAAGGCCTCAAAATAGGGTTCTACAAGAATACGTGCCCTCAGG
CTGAGGAGATAGTTAAGAAAGCGGCGGCGAGCTTCATTTCTCGAGCCCCCTCTCTTGCCGCTCCTCTCTTGAGGATGCATTTCCATGACTGCTTCGTCAGG
GTACTTCCATTTTAGCGNT
TAAATCNACTCGAGTNACCCCGTTGCCATCAATTTCTCAATTACTGCATGTNGTTTCTTTGAATCAAACATATGCANATCACTCCCCNCATCATTAATTTGTTGCGAAATAAGTTNTAGC
TATAATTAGTTGATGTGTAGAGATCTATCTTNATTAGATAACCAGTTTTATGTTAGTAGACACANTTGCNTTCCTTANAACAATCCNTCTCTNGATAATCAAACTTNATTNTGGAGGACA
CCTATGTTGTNCGCAGTCAANTGTCTCGTTTTCCTGATTCGAAACTTCATGNCATGAAATGAGACAAATTTACCATATTACAAATTCATGCAGAGGCANGCACCTTCACTNAGTTCTAAA
GTTCCTTTNTTTTTTGCCTTTCTTTCCCTCTCTTTTTTGGGTTTATTTGCAGGGATGTGATGGCTCTGTGCTACTGAATTCAACATCTTCTAACCAAGCAGAGAAAGATGCGTTTCCAAA
CCTGTCACTGAGAGGATNCCAAGTCATCGACGCAGCCAAAGATGCCCTTGAAAAAAAATGTCCTGGTGTTGTCTCTTGTGCTGATATTCTTGCTCTAGTTGCTCGTGATGCAGTTTCCAT
G
GTAATTGATTAATTAAAGATTCGATTCCTNTTGTATTCTAGCTAGGGATTTCTATAATACTGGTCATCAACGAAAATCGTTTCATAAATTCTATTTTTGTGATAAATCAAAATTTTTTT
ATCAATGATTTCGAATGGAATTGATTATCAAATTTTATTTCTGATGAGCGTGTTGACAACGCAAACTGATCAGAGTGCAAGTCATATGCACAGGTCATAAACTTGGACTCAACTAGTTCA
TGTGGTTTGCAGAGTGCTACACGGGTCTTTGTGTCCACTCCCCTAAATAACAAGTGATGTCAATTTATGAAATGTGACGTGATTTTTCTAAATTGTTGGTTGGATAACACAGCTAATGGA
TATGGAATTTCCNGTTTTTACTATGAAGGTATAGAGTAAGAATATCAAATATCTTTAACTTGTAATTGGTTTCAGATGAACGGTCCATATTGGCAAGTCCCCACAGGAAGGAGGGATGGC
AGAGTGTCTAAGCTNCAAGATGCCTTAAACAACTTGCCCGCTCCTACTTTCNGCATTTCTGCGCTTAAATCGTCCTTTGCCGNGAAGGGTCTCAGCGTCAAAGACCTTGCCGTTCTCTCA
G
GTACGAGACCAATCATAGTACATATACCTAACATTATTGAAAGTCCTAATNATTAGTTTATNATTTAAGTACAGTGAAATTAACGGTGTGGTTGATTCGATGATAATTCAGGAGGACAC
ACCCTCGGAATGTCNCACTGTTCCTCCTTCACGAACCGTCTGTACAACTTCACCGGCAAGAACGACGCCGACCCGTCCATGGACCCCAACTATGTCGCTCAGCTCAAGACCAAGTGCAAG
CCGAACGACGCCACCACCATCGTNGAGATGGACCCGGGGAGCGCCAAGACNTTTGACGTGGACTACTACACCCTCGTCTCNAAGAGGAGAGGCCTCTTCCAGTCTGATGCCGCGCTGCTC
ACCGACAGCACCACCAACGCCTACGTGCAGCTCCAGCGGACGAGCAAATCGACATTTGCCAAAGACTTTGGCGTGTCCATGGTGAACATGGGCAACATCGGCGTTCTCACCGGCAATTCG
GGCGAGATTAGGAAGAAATGCTATTTGGTTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTGCTCAGAAGCTTCTCTCTCTCCTGGTTTTCCAGCTCGCGCTCGTCGCTTTTATTCTCGACGTCGCCAATGCTCAAGGCCTCAAAATAGGGTTCTACAAGAATACGTGCCCTCAGG
CTGAGGAGATAGTTAAGAAAGCGGCGGCGAGCTTCATTTCTCGAGCCCCCTCTCTTGCCGCTCCTCTCTTGAGGATGCATTTCCATGACTGCTTCGTCAGG
GGATGTGATGGCTCTGTGC
TACTGAATTCAACATCTTCTAACCAAGCAGAGAAAGATGCGTTTCCAAACCTGTCACTGAGAGGATNCCAAGTCATCGACGCAGCCAAAGATGCCCTTGAAAAAAAATGTCCTGGTGTTG
TCTCTTGTGCTGATATTCTTGCTCTAGTTGCTCGTGATGCAGTTTCCATG
ATGAACGGTCCATATTGGCAAGTCCCCACAGGAAGGAGGGATGGCAGAGTGTCTAAGCTNCAAGATGCCT
TAAACAACTTGCCCGCTCCTACTTTCNGCATTTCTGCGCTTAAATCGTCCTTTGCCGNGAAGGGTCTCAGCGTCAAAGACCTTGCCGTTCTCTCAG
GAGGACACACCCTCGGAATGTCNC
ACTGTTCCTCCTTCACGAACCGTCTGTACAACTTCACCGGCAAGAACGACGCCGACCCGTCCATGGACCCCAACTATGTCGCTCAGCTCAAGACCAAGTGCAAGCCGAACGACGCCACCA
CCATCGTNGAGATGGACCCGGGGAGCGCCAAGACNTTTGACGTGGACTACTACACCCTCGTCTCNAAGAGGAGAGGCCTCTTCCAGTCTGATGCCGCGCTGCTCACCGACAGCACCACCA
ACGCCTACGTGCAGCTCCAGCGGACGAGCAAATCGACATTTGCCAAAGACTTTGGCGTGTCCATGGTGAACATGGGCAACATCGGCGTTCTCACCGGCAATTCGGGCGAGATTAGGAAGA
AATGCTATTTGGTTAAC

Retrieve as FASTA