1. Browse the Database
  2. View Redoxidase
Entry information : EguPrx22
Entry ID 11491
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-17 (Christophe Dunand)
Peroxidase information: EguPrx22
Name EguPrx22
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx22
start..stop		 S start..stop
EgrPrx21 625 0 1..311 9..319
EglPrx21 625 0 1..311 9..319
EguPrx21 625 0 1..311 9..319
EcamPrx21 620 0 1..311 9..319
Gene structure Fichier Exons►


exon

Literature and cross-references EguPrx22
Protein sequence: EguPrx22
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   311 (294)
PWM (Da):   %s   32380.95 (30531.9)  
PI (pH):   %s   8.15 (8.21) Peptide Signal:   %s   cut: 18 range:18-311
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
RSAFLLLLCFLLETASAQLSSTFYSTSCPSALSTIKSGVSSAVKSEARMGASLLRLHFHDCFVNGCDASVLLDDTANFTGEKNAGPNANSLRGFNVIDTIKSQLESACPGIVSCADLLTV
AARDSVVAVSGPSWTVPLGRRDSTTASQSAANSNIPAFTLSLSGLITAFSNKGFTAKEMVALSGSHTIGQARCTTFRTRLYNENNINxTFATSLKANCPSSGGDNNLSPLDTTSPTSFDN
AYFKNLQIQKGLLHSDQQLFSGGSTDAQVNAYSSNSATFMTDFANAMVKMGNLSPLTGSSGQIRKSCGKVN

Retrieve as FASTA  
Remarks Partial sequence from genomic (3 introns). Short 5' end is missing. No EST. Scaffold_1_736 (4153..6893).
DNA ►
Send to BLAST
CDS►
Send to BLAST