1. Browse the Database
  2. View Redoxidase
Entry information : EguPrx28
Entry ID 11496
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-03-10 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-10 (Achraf Jemmat)
Peroxidase information: EguPrx28
Name EguPrx28
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx28
start..stop		 S start..stop
EguPrx31 610 0 1..323 1..323
EgrPrx31 610 0 1..323 1..323
EglPrx31 607 0 1..323 1..323
EcamPrx31 603 0 1..323 1..323
Gene structure Fichier Exons►


exon

Literature and cross-references EguPrx28
Protein sequence: EguPrx28
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (300)
PWM (Da):   %s   34148.08 (31599.7)  
PI (pH):   %s   6.24 (5.95) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSSLNFFRALLLLFLATSAFSTRPYKEGLTPHFYDYACPQALPAVQRIVEAAVQQERRMGASLLRLHFHDCFVNGCDASILLDPSPTIDSEKLAFPNNNSARGFEVIDQIKAxVDKAC
GYSLVSCADILAIAARDSVVALGGPSWEVxLGRRDSTRASRTTANTDIPAPNMDLPSLISTFQKQGLxTRDLVALSGxHTIGFAQCRVFRNRTYNDxNxAADxAGSLQSLCPRTGEDSNL
AGLDPSPAQFDALYFHNLLAQKGLLHSDQALYSGGSTDELVKTYSDDVEAFWDDFAKSMIKMGNIKxxIGNQGQIRLNCRTVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). Intron 2 is very long.
scaffold_1_745 (38077..49220)
DNA ►
Send to BLAST
CDS►
Send to BLAST