Entry information : ZmPrx102 (Peroxidase 1 / GRMZM2G089895)
Entry ID 1150
Creation 2006-02-02 (Christophe Dunand)
Last sequence changes 2006-02-02 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Christophe Dunand)
Peroxidase information: ZmPrx102 (Peroxidase 1 / GRMZM2G089895)
Name (synonym) ZmPrx102 (Peroxidase 1 / GRMZM2G089895)
Class Class III peroxidase    [Orthogroup: Prx173]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type Mixed tissues
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx102
start..stop
S start..stop
SbPrx127 638 0 1..340 1..347
SiPrx90 584 0 1..340 1..336
OsPrx75 507 0 34..340 37..349
BdiPrx70 476 1e-170 21..340 17..341
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 156591448..156591684 237 N° 2 156591811..156591999 189 N° 3 156592101..156592266 166 N° 4 156592442..156592872 431
join(156591448..156591684,156591811..156591999,156592101..156592266,156592442..1 56592872)


exon

Literature and cross-references ZmPrx102 (Peroxidase 1 / GRMZM2G089895)
Literature Walbot,V., unpublished
Protein ref. UniProtKB:   B6TWB1
DNA ref. GenBank:   AC204581.2 (78164..79585)
mRNA ref. GenBank:   EU969276
Cluster/Prediction ref. UniGene:   Zm.97913
Protein sequence: ZmPrx102 (Peroxidase 1 / GRMZM2G089895)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   340 (314)
PWM (Da):   %s   36968.62 (34226.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   6.59 (6.04) Peptide Signal:   %s   cut: 27 range:27-340
Sequence 381
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWRERRRALLLLVAGAALGLIGAALASAPPEAALKVGFYHATCPIAEDVVLAEMRLILMEDATVAPSLLRMHYHDCFVQGCDGSIMLQSRKKGKAERDALPNRSMRGFDAIERIKARLETVCPLTVSCADIIAMAARDAVYLSHGPWYDVETGRRDGNVTVAEYVDNDLPPPDSNIVDVKTFFSVKSLNSKDIAVLFGCHSIGTSHCGPIQKRLYNFTGNMDGQDPSLDPAYAAELRKLCPPPRPGDDARKVKVPLDPGSNYTFDLSYYRHVLATGGLFQSDGSLLHDPVTRGYVEKVAKASSPDEYYADFAAAMVKMGRTDVLVGDHGEIRPTCGIFVD

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns) and 34 ESTs. Strain="B73", "Hybrid 35A19".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTGGAGGGAGCGGCGGCGGGCGCTGCTCCTGCTGGTGGCCGGCGCGGCGCTGGGACTGATCGGTGCCGCGCTCGCGAGCGCGCCGCCGGAGGCCGCGCTGAAGGTCGGGTTCTACCATG
CGACGTGCCCCATCGCGGAGGACGTGGTCCTCGCCGAGATGAGGCTCATCCTCATGGAGGACGCCACGGTCGCGCCGTCCCTGCTCCGGATGCACTACCACGACTGCTTCGTGCAG
GTAA
GCAAGCAAGCATCTGCATGCCGACGTAGCAGAGAGCTCAACTCTTCCAGCTCGCGTCGCATCCATGGAGAGGTGATATCATGATAATGTTATATTACTGGTTTGGTGTCACGCGATGCGA
AGGGCTGCGACGGGTCGATCATGCTCCAGTCGAGGAAGAAGGGGAAGGCGGAGCGGGACGCGCTGCCCAACCGTAGCATGCGAGGGTTCGACGCCATCGAGCGGATCAAGGCCCGGCTCG
AGACCGTCTGCCCGCTCACCGTCTCCTGCGCCGACATCATCGCCATGGCGGCGAGGGACGCCGTCTACCTG
GTAATTATTGATAAACCCGGTCGTTCGTTGGTTCGTTCGTGTGCTTATT
AATTTGCTCATCACCCGAATGCCTCTGCGCTGCTCTGTTCGTGACCAAACAGAGCCACGGGCCGTGGTACGACGTGGAGACCGGGCGGCGCGACGGCAACGTCACCGTGGCCGAGTACGT
CGACAACGACCTGCCGCCGCCGGACTCCAACATTGTCGACGTGAAGACCTTCTTCAGCGTCAAGTCGCTTAACTCGAAGGACATCGCCGTCCTCTTCG
GTAGCTGCCCGCCCACTCCTCC
TCCTCCTCCTTTCTTCTCCACCACCGCACCACCCGCCTAGTCCTAGCTACCTCTTTTCCGCGTGCGACAGCAACACGTTAGCAAACCACTCCAGTTAAGTACCGCTAGCTAGCTAACGGC
CGCGCTGTTGCCTTGGACGCGACGCGCATGCAGGGTGCCACAGCATCGGGACCTCCCACTGCGGCCCGATCCAGAAGCGGCTCTACAACTTCACCGGCAACATGGACGGCCAGGACCCGT
CGCTGGACCCGGCCTACGCCGCCGAGCTCAGGAAGCTCTGCCCGCCTCCCAGACCCGGCGACGATGCTAGGAAGGTCAAGGTGCCTTTGGACCCCGGCAGCAACTACACCTTCGACCTGA
GCTACTACCGCCACGTGCTCGCCACGGGCGGGCTGTTCCAGTCCGACGGCAGCCTCCTGCACGACCCCGTCACCAGAGGCTACGTCGAGAAGGTGGCCAAGGCGTCGTCGCCCGACGAGT
ACTACGCGGACTTCGCCGCGGCGATGGTCAAGATGGGCCGCACCGACGTGCTTGTCGGCGATCATGGGGAGATCAGGCCAACGTGTGGCATTTTTGTTGACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTGGAGGGAGCGGCGGCGGGCGCTGCTCCTGCTGGTGGCCGGCGCGGCGCTGGGACTGATCGGTGCCGCGCTCGCGAGCGCGCCGCCGGAGGCCGCGCTGAAGGTCGGGTTCTACCATG
CGACGTGCCCCATCGCGGAGGACGTGGTCCTCGCCGAGATGAGGCTCATCCTCATGGAGGACGCCACGGTCGCGCCGTCCCTGCTCCGGATGCACTACCACGACTGCTTCGTGCAG
GGCT
GCGACGGGTCGATCATGCTCCAGTCGAGGAAGAAGGGGAAGGCGGAGCGGGACGCGCTGCCCAACCGTAGCATGCGAGGGTTCGACGCCATCGAGCGGATCAAGGCCCGGCTCGAGACCG
TCTGCCCGCTCACCGTCTCCTGCGCCGACATCATCGCCATGGCGGCGAGGGACGCCGTCTACCTG
AGCCACGGGCCGTGGTACGACGTGGAGACCGGGCGGCGCGACGGCAACGTCACCG
TGGCCGAGTACGTCGACAACGACCTGCCGCCGCCGGACTCCAACATTGTCGACGTGAAGACCTTCTTCAGCGTCAAGTCGCTTAACTCGAAGGACATCGCCGTCCTCTTCG
GGTGCCACA
GCATCGGGACCTCCCACTGCGGCCCGATCCAGAAGCGGCTCTACAACTTCACCGGCAACATGGACGGCCAGGACCCGTCGCTGGACCCGGCCTACGCCGCCGAGCTCAGGAAGCTCTGCC
CGCCTCCCAGACCCGGCGACGATGCTAGGAAGGTCAAGGTGCCTTTGGACCCCGGCAGCAACTACACCTTCGACCTGAGCTACTACCGCCACGTGCTCGCCACGGGCGGGCTGTTCCAGT
CCGACGGCAGCCTCCTGCACGACCCCGTCACCAGAGGCTACGTCGAGAAGGTGGCCAAGGCGTCGTCGCCCGACGAGTACTACGCGGACTTCGCCGCGGCGATGGTCAAGATGGGCCGCA
CCGACGTGCTTGTCGGCGATCATGGGGAGATCAGGCCAACGTGTGGCATTTTTGTTGACTAG

Retrieve as FASTA