Entry information : EguPrx[P]37
Entry ID 11595
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-17 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-04-06 (Christophe Dunand)
Peroxidase information: EguPrx[P]37
Name EguPrx[P]37
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]37
start..stop
S start..stop
EgrPrx[P]37 229 6.44e-80 1..119 1..118
EgrPrx[P]40 145 1.73e-46 1..117 17..131
EgrPrx32 133 1.44e-39 1..119 17..134
EglPrx32 133 1.48e-39 1..119 17..134
Gene structure Fichier Exons


exon

Literature and cross-references EguPrx[P]37
Protein sequence: EguPrx[P]37
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   117
PWM (Da):   %s   12971.58  
PI (pH):   %s   6.22
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LTASALPTRPYNDGLSPHYxDYECPQASATIKRVIEAMVQQERRMGASLLRLHFHDCFVNCSKT**LLFSIAQYLLTLLFVWEFNNAGLWSFFIITIKVEFDGVCGCLVVSCVDILAIT

Retrieve as FASTA  
Remarks Pseudogene from genomic (Stops in frame, Short PS). Scaffold_1_752 (3026..2561)
DNA
Send to BLAST
CDS
Send to BLAST