1. Browse the Database
  2. View Redoxidase
Entry information : EguPrx[P]90
Entry ID 11605
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EguPrx[P]90
Name EguPrx[P]90
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]90
start..stop		 S start..stop
EgrPrx[P]90 614 0 1..312 1..312
EglPrx[P]90 518 0 1..312 4..271
EgrPrx[P]89 392 1.27e-138 60..312 43..291
EcamPrx[P]89 390 6.3e-138 60..312 34..283
Gene structure Fichier Exons►


exon

Literature and cross-references EguPrx[P]90
Protein sequence: EguPrx[P]90
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   310
PWM (Da):   %s   32911.53  
PI (pH):   %s   6.66
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LIFYHVGLHRL*MSYSILGDSSTSIQAALSVKLWSSRGSKRG*NKSSMACQQKMLMISRFEQGCDASLLLDDTEGFTGEKTAGVNINSIRGFDVVDNIKTRLEEQCPGIVSCADIIAVAA
HDSVAAVGPTWTVQLGRRDSTTASLKDANSDVPLGIADLSDLISLFSKKGFSAKEMVALSGAGVHTIGQARCFVFRIRIYNEKxIDPAYAASLRQNCPxAGGDANLVPLEDGDVDGKVFN
NDYFKNLVSMKGLLHSDQQLFNNGSTDADVKAYSLDSASFFADLANALVKMGNLSPLTGTDGQVRTNCRKVN

Retrieve as FASTA  
Remarks Pseudogene from genomic (Short 5' end is missing and Stops in frame).
scaffold_6_19754 (4085..5253)
DNA ►
Send to BLAST
CDS►
Send to BLAST