Entry information : EguRboh01
Entry ID 11609
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-02-16 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-16 (Achraf Jemmat)
Peroxidase information: EguRboh01
Name EguRboh01
Class Respiratory burst oxidase homolog    [Orthogroup: Rboh001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguRboh01
start..stop
S start..stop
EgrRboh01 1892 0 1..925 1..925
EcamRboh01 1622 0 137..925 1..789
EglRboh01 1602 0 75..925 6..856
VvRboh07 1474 0 3..925 10..917
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1658..2261 604 N° 2 2392..2548 157 N° 3 3286..3334 49 N° 4 3551..3664 114
N° 5 3793..4215 423 N° 6 4604..4987 384 N° 7 5088..5183 96 N° 8 5372..5487 116
N° 9 5572..5742 171 N° 10 5830..5986 157 N° 11 6070..6258 189 N° 12 6366..6494 129
N° 13 6686..6764 79 N° 14 7248..7387 140  
join(1658..2261,2392..2548,3286..3334,3551..3664,3793..4215,4604..4987,5088..518 3,5372..5487,5572..5742,5830..5986,6070..6258,6366..6494,6686..6764,7248..7387)


exon

Literature and cross-references EguRboh01
Protein sequence: EguRboh01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   936
PWM (Da):   %s   105562.86 Transmb domain:   %s   o364-386i445-464o500-522i545-567o577-591i727-744o
PI (pH):   %s   8.91
Sequence 977
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSKRSSYSRGFDLPEEFDDEEDEAAAAADYGSVGGAMLPVFLNDLRQNSQQDLVEVTLExEDDSIVVRSVTPTSNNNRAFAAAADENPDPAAAAAALDRNLSVTTRIRRKFPWLRSGSSRAGSEAEAPTAAAAAREARRARAKLDRSRSSAQRALKGLRFISKANFCARDAEELWRQVEVRFHRLARDGLLAREDFGECIGMDSKEFAVGMFDALARRRRQRIGKITREELHDFWLQISDQSFDARLQIFFDMADSNEDGRITRAEVQELLMLSASANKLSKLKERAEEYASLIMEELDPENLGYIELWQLETLLLQKDTYMNYSRTLSTTSVGWSQNLSSFRPTDKVRRICSSLRCLVLENWQRGWILLLWAIVMGCLFAWKFIQYRNMAAFQVMGYCLATAKGAAETLKLNMALILLPVCRNTLTWLxSTRARSFIPFDDNINFHKIIACAIVIGIILHAGDHLACDFPRLVNSSPEKFALISSDFNNRKPTYTDLLSGVEGVTGIAMVVLMAISFTLATHRFRRNIVRLPAPFNRLTGFNAFWYSHHLxGVVYVLLLIHGTFLYLVREWYRKTTWMYISIPLLLYILERSMRACRSNHYAVRILKVSVLPGNVFSIIMSKPQGFKYRSGQYIFLQCPTISPFEWHPFSITSAPGDDYLSVHIRTVGDWTQELKKTLTEGRDSSCVIGRAKFTSIGHIDQTGQPKLLVDGPYGAPAQDYRNYDVLLLVGLGIGATPFVSILRDLLSNTRAEEQMDSTTETSRSDDSTNSFASSNVTPGSKRKSQRTSSAHFYWVTRESGSFEWFKGVMNEVAEMDHKGQIELHNHLTSVYEEGDARSTLITMVQALNHAKHGFDILSGTRVRTHFGRPNWREVFIKVASKHPYTTVGVFYCGMPMLAKELRKLSHELSHKTSTRFEFHKELFQAEKTLKRTP*

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_3_7357 (1658..7387)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGGTCGAAGCGGTCCAGCTACAGCCGCGGGTTCGACTTGCCCGAGGAGTTTGACGACGAGGAGGACGAGGCGGCCGCTGCCGCCGACTACGGCAGCGTCGGCGGGGCAATGCTGCCCG
TGTTCCTCAACGACCTGCGGCAGAACTCGCAGCAGGACCTCGTGGAGGTCACCCTCGAGNTCGAGGACGACTCCATCGTCGTCCGCAGCGTCACCCCGACGAGCAACAACAACCGGGCGT
TCGCCGCGGCCGCCGACGAAAACCCCGATCCCGCGGCGGCGGCGGCGGCGCTGGACAGGAACCTGTCGGTCACGACGAGGATCCGGAGGAAGTTCCCGTGGCTGCGGTCCGGGTCGTCGC
GGGCCGGCTCGGAGGCGGAGGCCCCGACGGCGGCGGCGGCCGCGAGGGAGGCGCGGAGGGCGAGGGCGAAGCTGGACCGGAGCCGGTCGAGCGCGCAGAGGGCGCTGAAGGGTCTCCGTT
TCATCAGCAAGGCCAACTTCTGCGCCAGGGACGCCGAGGAGCTCTGGCGCCAGGTCGAGGTTCGCTTCCACCGCCTCGCCAGGGACGGCCTGCTCGCCCGCGAGGACTTCGGCGAATGCA
TCG
GTACGTTCTCCAAATCCCATCGCCATCGTTACAGTAGTGCATGCGAGACGTAGTGAAATGTGTGCGGACGGGTTGCGAAGGAAGTTGACGGTTGGCGGCGGTGGGTTTTGCTTTGCT
GTTGGAAAACCAGGGATGGACTCGAAGGAGTTCGCGGTGGGGATGTTCGACGCGCTGGCGCGGCGGCGGCGGCAGAGGATCGGGAAGATCACCAGGGAGGAGCTGCACGACTTCTGGCTC
CAAATCTCCGACCAGAGCTTCGACGCGCGGCTTCAAATATTCTTCGACAT
GTGGGCCCCCCTCTCCCTGTCTCTCTTTATCTCTCGATTCGTCTAGCCGTTTCGTGACCGTTCGATCGGA
TCGGAGCGATGGCTTCCTGGCCTCGTTGACCGTGCCTTTTCGATCGATCTGACGGCGGGGGATGCGGAATCCGAGGCAGGCCCGGCCGCCCCCTGGCCGCATGATCTCGCCCGAGGCTTC
CGGCGGTCATCTCTCGGGATGATCGCCGGCGTATTAATTGCCTGACAGAAAGAAAAGACGAGAAGTGTCGNTGAAGCTTTAATTTACTTGTCGGACTCCATTGATTATTATTACCCGCNA
AAANTGAAGTACATTGAATGTTACTTTTTGAAGAGCAAAAAGGATTTTNTCCAAATGGATTTTTGGTAGTGAATTTCGTGATTTTGAANGTACCCTTTCTTTGTCTTTTTACGTGTAATC
AACTCGTTGAAAATTAGAATTTATACACNAAGAATANCAGTTGTTATTAAGATCATGCTAGAGTTATTATTGTCTTGGTCGGGGCCCAAGTCGTCGATAATTGTTGGGAATTTCTGCTTT
CTTGGGTCATGAAAAAATTTAATGCTTTCATTAAAAATGGAGAGGAAAATCTTAGTTATTTTTTTGCGTATTTGAACTAGATTTAGTGTACCTCCTCAATTTACTTGGTAATTCATGTAA
CTTGACAAATGCCCTANAAGCCCTGATGAAAAGTCCTGACGTGTGTGTATCCTTTGTGCTTTATTAGGGCGGACAGCAATGAAGATGGGAGAATCACCAGGGCAGAAGTACAGGAGGTAG
GACTTTGTGCTTCCTCATCTGCAATTTCGAGTTTTGTCATCACATTACTCGAGCGTTATCAGCAGCGTGTCGTCCTTCTTTTAAGCTTGTCCATGTAGACGTGAATGGTACTTCCGGCTC
ACTAGCGAGATGATGCATCGGTTGTAGCTAAGAAAGAATGAACTGTTTCGTTTTACCGACACTTNGGAGCTTCACCAATGTCTTGATTTCAGCTTCTGATGCTCAGTGCATCAGCTAACA
AGTTGTCGAAGCTGAAAGAGCGAGCGGAGGAATACGCCTCCCTGATCATGGAGGAACTGGACCCGGAGAACCTCGGCTACATCGAG
GTAAAAGCCCCTGAAGCGGCAAAGCAAAACATAG
ATGACATAGGATATTCAACTTAGGAAAACTCTTTGCTCCATGGAAAGAAGTACTAATTCAGACAGGCTATCATTTGCCCTGTCCTCTGTTTCAGTTGTGGCAACTGGAGACTCTGCTTCT
GCAAAAGGACACTTATATGAACTACAGCCGAACGCTCAGCACGACCAGTGTTGGCTGGAGCCAAAACCTGAGCTCGTTTAGACCGACCGACAAGGTGCGGAGGATTTGCAGCTCCCTCCG
ATGCCTCGTGCTGGAGAACTGGCAAAGAGGTTGGATTCTGTTACTTTGGGCGATAGTGATGGGGTGCCTCTTCGCTTGGAAGTTCATCCAATACAGGAACATGGCAGCATTTCAAGTAAT
GGGCTATTGCCTGGCGACGGCCAAGGGGGCAGCAGAAACTCTGAAGCTCAACATGGCTCTCATCCTCCTGCCAGTCTGCCGGAACACCCTGACGTGGCTCNGGTCCACCCGAGCCAGGTC
GTTCATTCCCTTCGATGACAACATAAACTTCCACAAG
GTAAAAGATCTGGCGAAACAAGTAGAAACATCATGCATAAAGTTTTGAAATGTTGGTTCTCAACATCGTATCAATTGCTCCTG
GCTGAATTAAATTGGCATGGTTCGAAAACATAGTTTTTCCCAAGAATGGTGAAATTCACTATGGCAGGTAATAGAAGTAGAAGATTTAGAAAGAAAGTCTAAAGATTTCAATGGTTGCAA
CTTCCAGGGAATGCAATTCCATTAACATGCATGAGCTAAAGTGCATATGAACATGGCAAAGATATAAAGGAAGTACAGTTGTTCAAAGTGATTATTTCAAGCACTACTGTATTTTAGACC
AACTATATCTCGTGTATGCAAGAGATAATGGAATGACACTCCAGCACTTTTTTCCCANTGCACAGATAATTGCATGTGCCATAGTCATCGGGATCATCCTTCACGCAGGAGACCATCTAG
CATGTGATTTTCCCCGCCTGGTAAACTCCTCCCCAGAAAAGTTTGCCCTCATATCCTCTGACTTCAATAACAGAAAGCCCACATACACGGACCTTCTATCTGGAGTTGAAGGAGTGACGG
GCATTGCTATGGTGGTTTTGATGGCTATCTCATTCACTCTAGCGACACACCGGTTCAGGAGAAACATAGTGAGGCTACCTGCACCTTTCAACAGATTGACAGGTTTCAATGCATTCTGGT
ATTCCCATCACCTGNTAGGTGTGGTCTACGTTTTACTGCTCATCCATGGAACCTTTCTGTACTTGGTGCGCGAATGGTACAGGAAAACG
GTAAGCAATCCGTCTCATTGTATATGCCGTA
GTTAAGTCAAGACATCAAACTTCATCATGTATTCAATGGCACTGGTACTAATTCAATGCCTTACCTCAGACATGGATGTACATCTCTATTCCATTGTTGCTTTACATACTTGAGAGAAGC
ATGCGAGCATGCAGATCAAACCATTATGCAGTTCGGATATTGAAG
GTAATACCTTTCTNATTTCTCTTACATTTCGACTTTTCATTGTTTGATCAAGAAAAAGGACATAATATAATGCAC
AATTGAGAAAAAAATGCATCAGCGTCTTCATGCACGATCTTCGCAAAGTACATTGAGAAATTTGTTTTTCTGAAAAAAGCTAATTTCTTTTGGACTATGCTTGTTCTCTTCAGGTTTCGG
TTCTACCAGGGAATGTCTTCAGCATAATCATGTCCAAGCCTCAAGGGTTCAAGTACAGAAGTGGGCAGTACATTTTTCTACAATGTCCNACAATTTCCCCTTTTGAGTG
GTAAAGTCCAA
AACTCGTCTCACCTCCTAGCTTTTCCAACATCAGCATTTCCGCCATCTAAGGCTAAGTGCTGATACCTTCCAGGCACCCATTCTCAATTACTTCAGCACCTGGAGATGACTACCTCAGTG
TTCACATCAGGACAGTTGGTGATTGGACACAGGAGTTGAAAAAAACTCTCACTGAAGGCAGAGACTCGTCATGTGTNATTGGCCGAGCAAAATTCACGTCGATTGGGCATATCGATCAGA
CAGG
GTAATTATGTTTCTGGCAGGCTTAAGTTCCGAAATAGAAACTATTCTAGGTAATGCTAACTGAACAAACTGTCATGTCATGATGCAGCCAACCCAAATTGCTCGTCGATGGTCCAT
ACGGAGCTCCAGCTCAGGACTACAGAAATTATGATGTACTGCTCCTCGTGGGGCTTGGTATTGGTGCAACCCCTTTTGTAAGCATCCTTAGAGATCTTCTGAGTAATACAAGAGCAGAGG
AGCAAATG
GTACAGTATGTTGCTAATATATGAACAATGTGTCTTAAAATTTNGGAAACGCATCCTAAACTTTTGCTATTATGATGAACTAGGATTCAACCACAGAGACCAGTAGATCTGA
TGATAGCACAAATAGTTTCGCATCTTCAAACGTGACACCAGGCAGCAAAAGAAAGTCACAGAGGACGTCCAGTGCTCATTTCTACTGGGTGACTAGGGAATCCGGGTCGTTCGAGTGGTT
CAAAGGAGTCATGAATGAAGTTGCGGAAATGGATCACAAA
GTAAAATTCTTCTGAACATTGCTCATGACTGTTTAGTGCACGTGTAGAAGGAACTAAACGAGCGGGCTAAGAGACCCTAT
GTCTTCTCTCTCTTTCTGTATGAACAGGGTCAAATTGAGCTTCACAATCACCTTACCAGTGTCTATGAAGAGGGAGATGCAAGGTCAACTCTAATCACCATGGTCCAGGCTCTCAATCAT
GCCAAACACGGTTTCGACATCCTATCAGGGACACGG
GTATAATATGATGTCTACATAACAATGCCACATTCTGTTACGTTACCATGTTAACAATGAACACGCTACCGAGACAATTGACTA
GAGACACTATAGATAGAATATTCTTCTCTATTTTTTAGCTCGTTTGTTAAAGTGAACTGCTTCAACCGTGAGGCTGCTAACTCAGTCCTGATATTCGATACTTGCAGGTAAGAACACACT
TTGGAAGACCGAATTGGAGAGAGGTATTTATCAAAGTAGCTTCAAAGCATCCATACACTACAGTAG
GTAAGTGTAAAACAAGAAAGCATTAGTACTTGCTGACAAATTTCATAACAATCA
AACTAAGTAGTTCAGATCCCAGATACAATGAAATTACAAAAACTAGCTTCATTTGTTGCTGGTAATTAATCCTGAAATCATCATACAGGTAGAGCTCAGCACAATAGCCTTCTGATATTA
ACAATAACTAGACAAGACTTACAAATTGACATTAGGTCAGATGTAACTTCTGCAAATAAGAGACTTGTTTTTAAACTTGTAGGAGACCCTTAAACGCACTCTGTGGCCAAGTCTACATCA
GAAAATAATGCGAAGGATCAAAATATAAGATCTTAACTTTTGCGTAAATTATATANTAAAACCCTTGACTAGGANAGTAAAACCATCTCCTTAACGTNATGAAACTCTACAATGTTTGCT
GAATCTGCAGCTGTCGCAAGATACTGACGTTTCAATGATGTCTGAACGAAAGGGGTTTTTCTATTGCAGGGGTGTTCTACTGCGGGATGCCGATGTTAGCAAAGGAATTAAGGAAGCTAT
CGCATGAGCTGAGTCACAAGACATCTACACGTTTCGAATTCCACAAGGAGCTTTTCCAGGCTGAAAAAACATTGAAGCGCACACCATAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGGTCGAAGCGGTCCAGCTACAGCCGCGGGTTCGACTTGCCCGAGGAGTTTGACGACGAGGAGGACGAGGCGGCCGCTGCCGCCGACTACGGCAGCGTCGGCGGGGCAATGCTGCCCG
TGTTCCTCAACGACCTGCGGCAGAACTCGCAGCAGGACCTCGTGGAGGTCACCCTCGAGNTCGAGGACGACTCCATCGTCGTCCGCAGCGTCACCCCGACGAGCAACAACAACCGGGCGT
TCGCCGCGGCCGCCGACGAAAACCCCGATCCCGCGGCGGCGGCGGCGGCGCTGGACAGGAACCTGTCGGTCACGACGAGGATCCGGAGGAAGTTCCCGTGGCTGCGGTCCGGGTCGTCGC
GGGCCGGCTCGGAGGCGGAGGCCCCGACGGCGGCGGCGGCCGCGAGGGAGGCGCGGAGGGCGAGGGCGAAGCTGGACCGGAGCCGGTCGAGCGCGCAGAGGGCGCTGAAGGGTCTCCGTT
TCATCAGCAAGGCCAACTTCTGCGCCAGGGACGCCGAGGAGCTCTGGCGCCAGGTCGAGGTTCGCTTCCACCGCCTCGCCAGGGACGGCCTGCTCGCCCGCGAGGACTTCGGCGAATGCA
TCG
GGATGGACTCGAAGGAGTTCGCGGTGGGGATGTTCGACGCGCTGGCGCGGCGGCGGCGGCAGAGGATCGGGAAGATCACCAGGGAGGAGCTGCACGACTTCTGGCTCCAAATCTCCG
ACCAGAGCTTCGACGCGCGGCTTCAAATATTCTTCGACAT
GGCGGACAGCAATGAAGATGGGAGAATCACCAGGGCAGAAGTACAGGAGCTTCTGATGCTCAGTGCATCAGCTAACAAGT
TGTCGAAGCTGAAAGAGCGAGCGGAGGAATACGCCTCCCTGATCATGGAGGAACTGGACCCGGAGAACCTCGGCTACATCGAG
TTGTGGCAACTGGAGACTCTGCTTCTGCAAAAGGACA
CTTATATGAACTACAGCCGAACGCTCAGCACGACCAGTGTTGGCTGGAGCCAAAACCTGAGCTCGTTTAGACCGACCGACAAGGTGCGGAGGATTTGCAGCTCCCTCCGATGCCTCGTGC
TGGAGAACTGGCAAAGAGGTTGGATTCTGTTACTTTGGGCGATAGTGATGGGGTGCCTCTTCGCTTGGAAGTTCATCCAATACAGGAACATGGCAGCATTTCAAGTAATGGGCTATTGCC
TGGCGACGGCCAAGGGGGCAGCAGAAACTCTGAAGCTCAACATGGCTCTCATCCTCCTGCCAGTCTGCCGGAACACCCTGACGTGGCTCNGGTCCACCCGAGCCAGGTCGTTCATTCCCT
TCGATGACAACATAAACTTCCACAAG
ATAATTGCATGTGCCATAGTCATCGGGATCATCCTTCACGCAGGAGACCATCTAGCATGTGATTTTCCCCGCCTGGTAAACTCCTCCCCAGAAA
AGTTTGCCCTCATATCCTCTGACTTCAATAACAGAAAGCCCACATACACGGACCTTCTATCTGGAGTTGAAGGAGTGACGGGCATTGCTATGGTGGTTTTGATGGCTATCTCATTCACTC
TAGCGACACACCGGTTCAGGAGAAACATAGTGAGGCTACCTGCACCTTTCAACAGATTGACAGGTTTCAATGCATTCTGGTATTCCCATCACCTGNTAGGTGTGGTCTACGTTTTACTGC
TCATCCATGGAACCTTTCTGTACTTGGTGCGCGAATGGTACAGGAAAACG
ACATGGATGTACATCTCTATTCCATTGTTGCTTTACATACTTGAGAGAAGCATGCGAGCATGCAGATCAA
ACCATTATGCAGTTCGGATATTGAAG
GTTTCGGTTCTACCAGGGAATGTCTTCAGCATAATCATGTCCAAGCCTCAAGGGTTCAAGTACAGAAGTGGGCAGTACATTTTTCTACAATGTC
CNACAATTTCCCCTTTTGAGTG
GCACCCATTCTCAATTACTTCAGCACCTGGAGATGACTACCTCAGTGTTCACATCAGGACAGTTGGTGATTGGACACAGGAGTTGAAAAAAACTCTCA
CTGAAGGCAGAGACTCGTCATGTGTNATTGGCCGAGCAAAATTCACGTCGATTGGGCATATCGATCAGACAGG
CCAACCCAAATTGCTCGTCGATGGTCCATACGGAGCTCCAGCTCAGG
ACTACAGAAATTATGATGTACTGCTCCTCGTGGGGCTTGGTATTGGTGCAACCCCTTTTGTAAGCATCCTTAGAGATCTTCTGAGTAATACAAGAGCAGAGGAGCAAATG
GATTCAACCA
CAGAGACCAGTAGATCTGATGATAGCACAAATAGTTTCGCATCTTCAAACGTGACACCAGGCAGCAAAAGAAAGTCACAGAGGACGTCCAGTGCTCATTTCTACTGGGTGACTAGGGAAT
CCGGGTCGTTCGAGTGGTTCAAAGGAGTCATGAATGAAGTTGCGGAAATGGATCACAAA
GGTCAAATTGAGCTTCACAATCACCTTACCAGTGTCTATGAAGAGGGAGATGCAAGGTCAA
CTCTAATCACCATGGTCCAGGCTCTCAATCATGCCAAACACGGTTTCGACATCCTATCAGGGACACGG
GTAAGAACACACTTTGGAAGACCGAATTGGAGAGAGGTATTTATCAAAGTAG
CTTCAAAGCATCCATACACTACAGTAG
GGGTGTTCTACTGCGGGATGCCGATGTTAGCAAAGGAATTAAGGAAGCTATCGCATGAGCTGAGTCACAAGACATCTACACGTTTCGAATTCC
ACAAGGAGCTTTTCCAGGCTGAAAAAACATTGAAGCGCACACCATAG

Retrieve as FASTA