Entry information : EguRboh02
Entry ID 11610
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-19 (Christophe Dunand)
Peroxidase information: EguRboh02
Name EguRboh02
Class Respiratory burst oxidase homolog    [Orthogroup: Rboh001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguRboh02
start..stop
S start..stop
EgrRboh02 1984 0 1..965 1..965
EcamRboh02 1867 0 1..965 1..964
CclRboh01 1642 0 1..965 1..946
CsRboh01 1641 0 1..965 1..946
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35331..36039 709 N° 2 36153..36312 160 N° 3 36699..36747 49 N° 4 37499..37612 114
N° 5 39179..39601 423 N° 6 41142..41528 387 N° 7 41706..41801 96 N° 8 41914..42029 116
N° 9 42171..42338 168 N° 10 42455..42614 160 N° 11 42758..42955 198 N° 12 43056..43184 129
N° 13 43299..43377 79 N° 14 43472..43605 134  
join(35331..36039,36153..36312,36699..36747,37499..37612,39179..39601,41142..415 28,41706..41801,41914..42029,42171..42338,42455..42614,42758..42955,43056..43184 ,43299..43377,43472..43605)


exon

Literature and cross-references EguRboh02
Protein sequence: EguRboh02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   965
PWM (Da):   %s   108391.87 Transmb domain:   %s   o403-422i542-564o584-606i763-780o
PI (pH):   %s   9.44
Sequence 1006
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGLAKHGRRWASDTVPGKSPASDSTSPAGTEASYGEELVEVTLDLQEDDTIVLRSVEPATAASALTIKIDDDDGGGGGSGGGGSGAETPRAASSSAPSRSPTMRRSSSSRLRQFSQELKAEAVAKARQFSQELKAELRRFSWSHGHASRVLSASTSSAGQNAGGFDVALAARALRKQRAQLDRNRSGTQKALRGLRFISNxKTNCSIDAWNEIQASFDKLAKDGCLYRQDFAQCIGMKDSKEFALELFDALGRRRRMKVDRISKDELYEFWCQITDQSFDSRLQIFFDMVDKNEDGRITGEEVKEIIMLSASANRLSRLKEQAEEYAALIMEELDPEQLGYIELWQLETLLLQKDTYLNYSQALSYTSQALSQNLQGLRRRSRIRRLSTKCLYYLEENWRRIWVVTLWVMIMIGLFTWKFVQYKQKAAFQVMGYCLLTAKGAAETLKFNMALILLPVCRNTITWLRNTRVGLFIPFDDNINFHKTIAAAIVVGVILHVGDHLACDFVRLEQASKDVYHRYLEDDFGNPKPTYFDLVKGIEGVTGILMVILMVIAFTLATRWFRRSLVKLPKPFDRLTGFNAFWYSHHLFVLVYILLIIHGVFLYLVHHWYRKTTWMYLAVPVLLYAGERTLRFFxSGMYTVRLLKVAIYPGNVLTLKMSKPPQFKYKSGQYMFVQCPAVSPFEWHPFSITSAPGDDFLSVHIRQLGDWTQELKRVFAEACETPVAGKSGLLRADETTKKSLPKLCIDGPYGAPAQDYKKYDVLLLVGLGIGATPFISILKDLINTIVKSEEQADSVTDVSRNSDLSIGSVESPGPNRVSPRRRKTLKTTNAYFYWVTREQGSFDWFKGVMNEVAEIDQRGVIEMHNxLTSVYEEGDARSALITMVQALNHAKNGIDIVSGTTVRTHFARPNWKKAFNKLCSKHSGARIGVFYCGAPVLAKELSKLCYEFNQKGPTKFDFHKEHF

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_5_14931 (35331..43605)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGGGCCTCGCCAAGCACGGGCGCCGGTGGGCGTCCGACACCGTCCCCGGCAAGTCACCGGCCAGCGACAGCACTTCGCCGGCGGGTACGGAGGCCAGCTACGGCGAGGAGCTCGTGG
AGGTGACCCTCGACCTGCAGGAGGACGACACGATCGTCCTCCGCAGCGTCGAGCCCGCCACGGCAGCCTCCGCGTTGACTATCAAGATCGACGACGACGACGGCGGCGGCGGCGGCAGCG
GCGGCGGCGGCAGCGGGGCCGAGACGCCCCGCGCGGCTTCCTCCTCGGCCCCGTCCCGGTCGCCGACGATGCGCCGCAGCTCGTCGAGCCGGCTCCGGCAGTTCTCGCAGGAGCTGAAGG
CGGAGGCGGTGGCCAAGGCGCGGCAGTTCTCGCAGGAGCTCAAGGCGGAGCTGCGGCGGTTCTCGTGGAGCCACGGCCACGCGTCCCGCGTGCTCTCAGCGTCCACGTCGTCCGCCGGCC
AGAATGCCGGCGGCTTCGACGTGGCCCTGGCGGCCCGGGCCCTGCGGAAGCAGCGCGCGCAGCTCGACCGGAACCGCTCGGGCACCCAAAAGGCCTTGCGCGGGCTGCGGTTCATCAGCA
ACANCAAGACCAACTGCAGCATCGATGCATGGAACGAAATTCAGGCTAGCTTCGATAAGCTTGCCAAGGATGGTTGTCTCTATCGTCAAGATTTCGCACAATGCATAG
GTTTTCGCCATC
TCTCTCTCTCTCTCTCTCTCTCTAAATTCACGTCCCTTTATGGTGGATTTCTCTCCTTAGCGTTCATACTGACGACGTCCTTGTCTTTTTTCCCGGTGAAGGAATGAAAGATTCGAAGGA
GTTTGCTTTGGAACTGTTCGATGCATTGGGGAGGAGGAGGAGAATGAAGGTCGACAGGATCAGCAAAGACGAGCTCTACGAGTTCTGGTGTCAGATCACTGATCAGAGCTTCGATTCACG
TCTCCAGATCTTCTTCGACAT
GTACGCATGATGATCGCGATGATGATGATGAATTAAAAAAAAAGAAAAAGAACCAACTTGATAACTTTTTTAATTATTTTTATTTTTTTTTACACTGTT
GTGTTTTGATAAAGATTGCACTTCTTTAACAAACTAAGGAACAGACCGATTCATCTCCATTAGGTATTTTTAATTATTTTCATATTAACGCGAGATGATTGTGTATTGTCAGTGGGTAAA
GAGCCAGAAGCGAGAAAAGCAAGAACAGGGACCGCTGAACAATATCTTAATTATGGACCTAATTATTGATCGAGTCATATGTTTTTTATTTGCACCTAGTACGTTTTTCATTAAAAACAA
TCTGTTTGGTCGATAATTAATCTTTTCTCTTGTTGAATACATGACAGGGTAGACAAGAACGAGGACGGAAGAATCACCGGAGAAGAAGTAAAAGAGGTGAGAGTTCTGTTTGAACCGATT
GTCATTAGCTGTCATTTTCGAGAAAANTANAGCTCGATTAGACCNGGCGACCCTGTTAAACTAAACTCCTACACTGATTATATATATGCGCAATAGATTGGACCGTACATAATTAATTGG
AATAGGAACTAATGTGCATGAATTAGCCAACACTCCTTCATGTCCTCGTGTAAGCCATCATAATAAACTAGGTTTTCCTTACAGGGTGTCATGTTTCGGTTACAATATAATAATCGATGT
TAGGCGAGGTTCGGTGAGCCCCAAAAATCCCTGAAATTCCACAACGAAACTACTCCATCACAACGATAACAAAAAAAAGAAAGCGAAGTTTTATAGAATAATATTTNGGTTTTTTCTTTT
TTCCTTCCCGGGCTTGCTCTGACGTTGCCCATGTTCTAAAAGCATCTTCTTATTCATTAAAGATTTTTTGGGGGTATTCGTGGGTTTCCATGNGCTCTTAGGCCCCCTANTCCGTGATGT
NTAGGGGGACAAATGGCAAGTTTTCTCCACTACAATCTTATTCCCGAACGCAATAATTACTATTTTCAGTGGGGTTGGTGGGGGCTTTTCGGTCAACTCGGGGCCGGTCCGACGTGTTAC
GGTTGTCTTCTTGATGCATGCAGCCTTGGGTTACGTGGACCTGCGAGTCATTAATGCCCGTTTGACGTAAAGAACCCTAATTTCCACAGTTCCTGTTCTTGATTTTGATTGCTGCCGATG
GTTGCAGATCATAATGCTGAGCGCCTCGGCGAATCGATTATCGAGGTTGAAGGAGCAGGCGGAGGAGTACGCAGCTCTGATCATGGAAGAACTGGATCCGGAGCAGCTCGGCTACATCGA
G
GTCGGTCCATTTTNTTATTTTATATTTATGATTTCGCCCTAAAATCTAAAGATAATGCAAAGTCCAAAATACATATATTTCGTCAGACTATAGTTTTCCCAATAGTTAGTGGGGATACG
CATCTTAATCGAGTCAGCTTTGACCAGTAGTTTTTTTATAAGAGTAATACTCGAGGGGGTCTAAGTATTAGTTACGACTTTTCCTCCTAAAGTCCATGTTTGGCGAAAAATGGAAATTTT
TTTCTAAGAATTGGGTAACCGTGTTGTTGAACCGCGCNAGAAGAAAATAGTAAAAGCTTATGANTATNTATAAATATATGTGTGTATATATTCATATTAATATTTGTAGACGTAGCTAGC
GCATTACTTTTGGATTGACCAAATTAGATTGTTTAGAAGGCAAAAGCAGCTGACGAAATTTCTAAAANTTTTGGTAGTTGAGCGACTTTTCTTCGACCTTCAAGCCNATTTCTTCTAAAA
GTTTCGGTAATTAGGGTTTCTCCTTTCCGTCGTAACTTTGTTATTTCTAGGTCAGTGCAATAATTGGGACGACCGATAAGCCACGCATNTCATGTCATCTTCCTTACTTTGTTGTCCTTA
ATCAAGCAATAAATCTAGGGTCCGATTGNATGGACTTAAATCAAAATGGCAAAAAAAANAAANAAATTNGTGGCCGATACATTAACACAAGCTGTTTTATCATGTAGTTACAGCCAAAAA
GAANGGAAGCCTTAACATAATAAATTCTCAAATAATTATATTCGTAATCGTTTTATTTATTNCTTAAGTATATAGCAAGANTAGGTGAGTTCCGGTCTTTCTGGGTCCGAGAGCATGTCC
ATCGCGCCTGCGTTTGACACCTTTCCTGGCTGTACTCACACGACGAATCTTCTGCACTAAATTCTCATTTTTCTTTTCTTTTCTCGGCTGCTAAAAATTTTCCGGGGAAATTTCAGTCCT
CCCAATGGCGGAGAAAAACCGACGTAGATATACATCGCGATTGGTGGCATGTAGCTTGTCGGAACGAGTAGGTGGGGGGGGCTCTTCGGGGTGCCCCACGCACGACCGCGTAGACCACAC
CCCGTGCACGAAATTCCCCCGCGTGCTGTCCCGTTTCGGTGGTCACCGTCGCTGGGGGGTCTGTCGAGCTTTTTCTCGACCCGATCCCTCTTTTGTCTTTTCCGCCTCGTCCCATCCCAC
GATTCCGATCCTAAAGAGACGCTCGTTGAATTCGCGAGTTTCCGTGATGGCGAACATTGGGAACGATGGGAAGCGCCAGACTTCGAGACTAACAACATCACGTTTTCCTTTAACTAAAAC
TGATGTCATCGTATGCATCGAACGTTTCTTGCTTTTGGTCACATGCGACGGTGACGCATCGATTCCATGGATCGAGGGGCGGTGCCCATGTCATGCACAAAGCTTTCTACTCATGGCAGA
AAAAAAGAGGAGGAAAAATCCCACTTAAAATGNAANTGACATGGGAGAAAAGTAAAATTTTACCGGCTTTAGCTTGCAATTTAGCCTGCAATTTAGCCCCTGAATTCTNGGTGAAAATCG
GATGCAGCTATGGCAACTGGAGACGCTGCTGCTACAGAAGGATACGTACCTAAACTACAGCCAGGCGCTGAGCTACACGAGCCAAGCGCTGAGCCAAAACCTGCAGGGCCTGAGGAGGAG
GAGCCGCATCAGGAGACTGAGCACCAAGTGCCTGTACTATCTGGAAGAGAACTGGAGGAGGATTTGGGTGGTGACCTTGTGGGTCATGATCATGATCGGCCTCTTCACCTGGAAGTTCGT
GCAGTACAAGCAGAAGGCCGCCTTCCAGGTCATGGGCTATTGCCTCCTCACGGCGAAGGGGGCCGCCGAGACGCTCAAGTTCAACATGGCCCTCATCCTGCTGCCGGTGTGCCGGAACAC
CATCACTTGGCTCCGCAACACGAGGGTCGGCCTCTTCATACCCTTCGACGACAACATCAACTTTCACAAG
GTGCGCAAATTTTACCTCTTTCCTAACTTTTGATTTACTATATAGGCTAT
CTCAAATTCATGCCAAATGCTTTTCGTGAAATGCTGTATTATTACCAGAATTGATACCGTGGACTTNGCTACATCCTCAATATTGAACATTCCATATGTTGCGGATCCAATCATGAACCG
ACAGCTCGAGCAACCCATGCCCAGTGCCCCTAACGCATGCTCCATGACTGATGTGCATATTTTTAAGCTTATAAAAATTTCGGAATAAATTAGGTCCGACCTATGGAAATTAAACAGGTC
TAATCCATCCGTATGATTAAAACTTTCANCTTAATCACGGAACCTAACCCTCCTTTTTGAAATTTCCAATCCTTCGATTATTTTCCACATCATTGAGCTAGTTTTGTCCTCCTATAGGTG
GTGGAAACTTTGGTTGCATACAATTTTTTTCCCTTGGGGCCCCACGAGGAGGATTTCTGGTGAAANTCAACGTGATTGATTTGATCTGGACACTCGTTTTTTAAAGGGAAAAAAAACTGA
TTCCTGATATGTCTCTTTGGGTGCACATAGATGATGACGATATGTCCTGTGTTAGAACGCGTGTAGTGCAGTGCAAGGCATCATCTTTCTGCTTAAAGGCAGCAAAGGTTGACAAATGAG
AATCTTCCCCTGGGCCAGAGAGATCACGATTGTTTTTGTTTGTATGCAGAGAATTAGAAGAACTTGTGGAAAGCCATAAAGATTGACTCTTTTTTTTTCCTCCCCTTAACGAGTTGAAAA
NTGAGAAAAAAACATGTGGAAAAGGAAACTCTGTTCAGCCTAAAATGATTCCTTGTGATGATTGCGTGTTAGTTTATAGACTATGAAGCTTTTGTTTATATGTATGAGCTAGTTANGCTA
GGAGATTGACTTCTTAGTGACATAAAGAAAGGATCTCTTGCATTTCCCAAGATCCTTAAGAAGAAACTCTGTTTTGTGGCATTGTAAATTGGCAGGAGAGCAAGAATGCACCGATCATTG
CTTGAATAAATTTCGATACAGAAAATCACAACTTAAAGCGTGACAAGATACAGATGTGATGGATAGAACAAATGTAGATTGTGATTTTCAGGTTCTGAACATGGAGAGGAAGAGAGATTG
GCTAATCAAATGACAGATTTTATATTGCAATGTCATTCTAAGTGATAATGTCTGATATGATGCAAAATGCTGCTCAGATATGTAGAACTACGCATGTGATGGGGAATGACATTCCTAGGA
TCTTTTAGGTTGTCTGATTAGTGAAAAAGCAAGAATTCTGAGAAGAGAATGTTTTTTTTTTGAGGTCAGTGATCTTAGCGACGGAAGCAATGTCTCCACCATTTGCATAATTACCGGAGT
CATGCTTTTTACTGATACTTTGGATTAATGAGAAACTGAAACGTTGTCCCCTTAGCCTAGCAGCTAGTGAATCATCAGTTATTANTGATGGGATGATACTTGAGTTTCAGGATTCATAGC
AAGAATTGCAACATCTGAATAATATCTTTCTGGTTTGTACATTGGTGCAGACGATTGCTGCTGCTATTGTAGTTGGTGTCATCCTCCATGTGGGTGACCATCTTGCGTGCGATTTTGTGA
GGCTTGAACAAGCGTCTAAAGACGTCTATCATAGATACTTGGAGGATGATTTTGGTAATCCGAAGCCGACGTACTTTGATCTTGTCAAGGGGATTGAAGGNGTGACTGGGATCCTCATGG
TGATCTTGATGGTAATAGCCTTCACATTGGCTACCCGATGGTTCCGCCGAAGCCTCGTCAAGTTACCGAAACCATTCGACCGGCTCACTGGTTTCAATGCATTTTGGTACTCACACCACC
TGTTCGTGCTCGTCTATATCCTGCTCATCATTCACGGAGTCTTCCTTTACCTCGTTCACCACTGGTACCGCAAGACG
GTACGAATCGTTTTCTTTCCCTGCATTCCATGAACTTTCTGAG
AATTAGGCATCTTCAATGTGCTGCGTTCTTTTTCCAACATTGAAATATTGAAAGACAGCTGGTGTANTCCTAACGTAGTCGCATCTAAGTCCGCAGGACTTGAGTTTTGAAATGTGGAGT
TTGTGTCCTTGCAGACGTGGATGTATCTTGCTGTTCCTGTATTGCTCTATGCCGGAGAAAGGACCCTGAGATTCTTCAGNTCTGGAATGTACACNGTNCGACTGCTGAAGGTAACAAAAG
CATTCCCGCGTCATCCATCTTCATNATTTGNNNNNCATCTTCATTTGTTGGGCCTTCAATTAAAATTGTTGACATTCAGAGCGAATCGTCTTGATTGTGAAGGTTGCGATCTACCCAGGA
AATGTCTTGACGTTAAAGATGTCGAAGCCTCCCCAATTTAAGTACAAAAGCGGGCAGTACATGTTTGTCCAGTGTCCTGCGGTTTCTCCATTCGAGTG
GTAAGTCCCCAAGTAATGACGA
TAAGTGTCACTGAGGACAATGCATTTTGCTTATGGTAATGGCCTTCTTGAGCGGACTGCTCAACTGCATATGGTCTCCTCGCATACATACTGATCTCTACTCCCGACACACATTGGCAGG
CACCCATTTTCGATAACCTCAGCTCCCGGTGACGACTTCCTCAGTGTTCACATCCGTCAACTTGGCGACTGGACGCAAGAGCTCAAAAGGGTGTTCGCCGAGGCTTGTGAGACTCCTGTT
GCAGGAAAGAGTGGCCTCCTCAGGGCTGATGAAACAACCAAGAAAAG
GTGTGCACAGTTCCTGTTCCATTCTTTCGTTGTCCACACGCTATANTTTTCCGATAACTGAACATGAGCTTGT
GGAATTAATGATAATCAAGACCACATTCCTTTGTTGATTACAGTTTGCCGAAGCTCTGCATAGACGGCCCATATGGCGCTCCAGCACAAGACTACAAAAAATACGATGTGCTGCTGCTGG
TTGGTCTCGGAATTGGGGCAACGCCTTTCATTAGTATCCTCAAAGATTTAATCAACACCATTGTCAAAAGCGAGGAGCAAGCA
GTAAGTACTACATANTCTTTAACTTTTTAATTACCTT
TTGAACAACATGATCNTGGACTGATGATGCAAATGAGAATGAATTGGCATTGTACCTGTGAGAATTCAAGACCAATTTTCCTTTTGCCTCCTTTCTTTGTTTGCAGGACTCAGTCACAGA
TGTCAGTAGGAACTCGGATTTAAGCATCGGGAGCGTCGAGTCACCTGGCCCGAACCGGGTCTCCCCAAGGCGCAGGAAGACTCTGAAAACNACCAATGCGTACTTCTACTGGGTGACGAG
AGAACAAGGGTCATTCGATTGGTTCAAGGGGGTCATGAATGAGGTCGCGGAGATTGACCAAAGG
GTAAGAAAGAGTGCTTTCTCTTGAGCCCAATTTTCAGCTCATTAATCGAATTGATT
GAAGTTTTGTCTTTACTGATCACGTTCTGGTGTGGGACTTCTAGGGGGTGATTGAGATGCACAATTANTTGACCAGTGTGTACGAGGAAGGTGATGCAAGATCAGCTCTCATCACTATGG
TCCAAGCTCTTAATCATGCCAAGAATGGGATAGACATTGTGTCTGGGACAACG
GTAAGTATCCTTCTTCCTCTTCTTCTTTTGTCAATTTAATATTTGTTGTTTTCTTTTCCAATCCACA
ACCGTACGTCACATCCTGAATCGCAAAATGGAAACGTTTGCATTCAGGTAAGGACTCATTTTGCAAGACCCAACTGGAAAAAGGCTTTCAATAAACTATGCTCCAAGCACAGCGGTGCAA
GAATAG
GTAATTCTCAACCCAGTTGAATCACAGAANCTACTTAATCAATCTTCAAATATTCANTTTTTATTCCTTCTTTTTTTGGGCTTCCTTGAATCAGGTGTTTTCTACTGTGGAGCG
CCTGTTCTGGCCAAGGAGCTGAGCAAGCTCTGCTACGAATTCAACCAGAAAGGCCCCACCAAATTCGACTTCCACAAGGAGCATTTCGAAACTCTCCTTCTTTTTCTGTCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGGGCCTCGCCAAGCACGGGCGCCGGTGGGCGTCCGACACCGTCCCCGGCAAGTCACCGGCCAGCGACAGCACTTCGCCGGCGGGTACGGAGGCCAGCTACGGCGAGGAGCTCGTGG
AGGTGACCCTCGACCTGCAGGAGGACGACACGATCGTCCTCCGCAGCGTCGAGCCCGCCACGGCAGCCTCCGCGTTGACTATCAAGATCGACGACGACGACGGCGGCGGCGGCGGCAGCG
GCGGCGGCGGCAGCGGGGCCGAGACGCCCCGCGCGGCTTCCTCCTCGGCCCCGTCCCGGTCGCCGACGATGCGCCGCAGCTCGTCGAGCCGGCTCCGGCAGTTCTCGCAGGAGCTGAAGG
CGGAGGCGGTGGCCAAGGCGCGGCAGTTCTCGCAGGAGCTCAAGGCGGAGCTGCGGCGGTTCTCGTGGAGCCACGGCCACGCGTCCCGCGTGCTCTCAGCGTCCACGTCGTCCGCCGGCC
AGAATGCCGGCGGCTTCGACGTGGCCCTGGCGGCCCGGGCCCTGCGGAAGCAGCGCGCGCAGCTCGACCGGAACCGCTCGGGCACCCAAAAGGCCTTGCGCGGGCTGCGGTTCATCAGCA
ACANCAAGACCAACTGCAGCATCGATGCATGGAACGAAATTCAGGCTAGCTTCGATAAGCTTGCCAAGGATGGTTGTCTCTATCGTCAAGATTTCGCACAATGCATAG
GAATGAAAGATT
CGAAGGAGTTTGCTTTGGAACTGTTCGATGCATTGGGGAGGAGGAGGAGAATGAAGGTCGACAGGATCAGCAAAGACGAGCTCTACGAGTTCTGGTGTCAGATCACTGATCAGAGCTTCG
ATTCACGTCTCCAGATCTTCTTCGACAT
GGTAGACAAGAACGAGGACGGAAGAATCACCGGAGAAGAAGTAAAAGAGATCATAATGCTGAGCGCCTCGGCGAATCGATTATCGAGGTTGA
AGGAGCAGGCGGAGGAGTACGCAGCTCTGATCATGGAAGAACTGGATCCGGAGCAGCTCGGCTACATCGAG
CTATGGCAACTGGAGACGCTGCTGCTACAGAAGGATACGTACCTAAACT
ACAGCCAGGCGCTGAGCTACACGAGCCAAGCGCTGAGCCAAAACCTGCAGGGCCTGAGGAGGAGGAGCCGCATCAGGAGACTGAGCACCAAGTGCCTGTACTATCTGGAAGAGAACTGGA
GGAGGATTTGGGTGGTGACCTTGTGGGTCATGATCATGATCGGCCTCTTCACCTGGAAGTTCGTGCAGTACAAGCAGAAGGCCGCCTTCCAGGTCATGGGCTATTGCCTCCTCACGGCGA
AGGGGGCCGCCGAGACGCTCAAGTTCAACATGGCCCTCATCCTGCTGCCGGTGTGCCGGAACACCATCACTTGGCTCCGCAACACGAGGGTCGGCCTCTTCATACCCTTCGACGACAACA
TCAACTTTCACAAG
ACGATTGCTGCTGCTATTGTAGTTGGTGTCATCCTCCATGTGGGTGACCATCTTGCGTGCGATTTTGTGAGGCTTGAACAAGCGTCTAAAGACGTCTATCATAGAT
ACTTGGAGGATGATTTTGGTAATCCGAAGCCGACGTACTTTGATCTTGTCAAGGGGATTGAAGGNGTGACTGGGATCCTCATGGTGATCTTGATGGTAATAGCCTTCACATTGGCTACCC
GATGGTTCCGCCGAAGCCTCGTCAAGTTACCGAAACCATTCGACCGGCTCACTGGTTTCAATGCATTTTGGTACTCACACCACCTGTTCGTGCTCGTCTATATCCTGCTCATCATTCACG
GAGTCTTCCTTTACCTCGTTCACCACTGGTACCGCAAGACG
ACGTGGATGTATCTTGCTGTTCCTGTATTGCTCTATGCCGGAGAAAGGACCCTGAGATTCTTCAGNTCTGGAATGTACA
CNGTNCGACTGCTGAAG
GTTGCGATCTACCCAGGAAATGTCTTGACGTTAAAGATGTCGAAGCCTCCCCAATTTAAGTACAAAAGCGGGCAGTACATGTTTGTCCAGTGTCCTGCGGTTT
CTCCATTCGAGTG
GCACCCATTTTCGATAACCTCAGCTCCCGGTGACGACTTCCTCAGTGTTCACATCCGTCAACTTGGCGACTGGACGCAAGAGCTCAAAAGGGTGTTCGCCGAGGCTT
GTGAGACTCCTGTTGCAGGAAAGAGTGGCCTCCTCAGGGCTGATGAAACAACCAAGAAAAG
TTTGCCGAAGCTCTGCATAGACGGCCCATATGGCGCTCCAGCACAAGACTACAAAAAAT
ACGATGTGCTGCTGCTGGTTGGTCTCGGAATTGGGGCAACGCCTTTCATTAGTATCCTCAAAGATTTAATCAACACCATTGTCAAAAGCGAGGAGCAAGCA
GACTCAGTCACAGATGTCA
GTAGGAACTCGGATTTAAGCATCGGGAGCGTCGAGTCACCTGGCCCGAACCGGGTCTCCCCAAGGCGCAGGAAGACTCTGAAAACNACCAATGCGTACTTCTACTGGGTGACGAGAGAAC
AAGGGTCATTCGATTGGTTCAAGGGGGTCATGAATGAGGTCGCGGAGATTGACCAAAGG
GGGGTGATTGAGATGCACAATTANTTGACCAGTGTGTACGAGGAAGGTGATGCAAGATCAG
CTCTCATCACTATGGTCCAAGCTCTTAATCATGCCAAGAATGGGATAGACATTGTGTCTGGGACAACG
GTAAGGACTCATTTTGCAAGACCCAACTGGAAAAAGGCTTTCAATAAACTAT
GCTCCAAGCACAGCGGTGCAAGAATAG
GTGTTTTCTACTGTGGAGCGCCTGTTCTGGCCAAGGAGCTGAGCAAGCTCTGCTACGAATTCAACCAGAAAGGCCCCACCAAATTCGACTTCC
ACAAGGAGCATTTCGAAACTCTCCTTCTTTTTCTGTCTTAG

Retrieve as FASTA