Entry information : FpsAPx-CcP1
Entry ID 11618
Creation 2012-12-21 (Marcel Zamocky)
Last sequence changes 2016-02-23 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-23 (Achraf Jemmat)
Peroxidase information: FpsAPx-CcP1
Name FpsAPx-CcP1
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Sordariomycetes Fusarium
Organism Fusarium pseudograminearum    [TaxId: 101028 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FpsAPx-CcP1
start..stop
S start..stop
GzAPx-CcP01 1024 0 1..530 1..530
GmoAPx-CcP01 756 0 1..526 1..526
FoAPx-CcP01 749 0 1..526 1..526
CgloAPx-CcP03_Naragc5 506 3.22e-176 5..531 7..539
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11618' 'complement(join(101885..103341,103392..103530))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 103392..103530 137 N° 2 101885..103341 1455  
complement(join(101885..103341,103392..103530))


exon

Literature and cross-references FpsAPx-CcP1
Protein ref. UniProtKB:   K3UEA5
DNA ref. GenBank:   AFNW01000321.1 (103530..101885)
Protein sequence: FpsAPx-CcP1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   531 (573)
PWM (Da):   %s   57267.89 (65977.8)  
PI (pH):   %s   9.28 (6.45) Peptide Signal:   %s   cut: 36 range:24-596
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKGPSTVAIALVPFTAAKQLVWPSKFDYLEDLQYNQDGYNKFGFA
D
ALVTCTFGNSQPGRQNSAEWIRTAFHDAVTHDAKAGTGGLDASIFWETTRAENAGKAWDNTFSFFDGFYNQRASAADLIALGTVVATGGCYGPDVPFRAGRIDAGKPGPTGVPEPSTNLK
ETFAAFQKAGFTKEDMTAMVACGHALGGVHSVDFPDVTGIKADPNNDTSVPFQKDISSFHNGVVTEYLDGTTKNPLVVAKNNTLNSDKRIFDNDRATMKKLSTKQGFNTMCADIFARMID
TVPKSVQLSDVISPYDVKPYVTELSLNSKGKIVFKGSVRLMTTNKIRDGDDLIVELVYMGHNGKKTTVPTNRAMWRSGATFGSGQQFVNFEFDTTIDAKNGITKFWIKETKKSTKVSKSH
DNQGTHGYKVDDTVLYQISDSCLAADQLPGAPMTIAAVVRDSQAKNALTLKAVDRVDQKGTIVPKLQTKVVSFKATGKKANGYTAFKAQTKINNNNIRFDIALAGSPTAGVQFQAVIAIP
TGSCN

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). Strain="CS3096".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGGCCCTTCCACTGTCGCTATTGCTCTCGTTCCCTTCACAGCTGCCAAGCAGCTTGTCTGGCCCTCAAAGTTTGATTACCTTGAGGATCTCCAGTACAACCAGGACGGATACAAC
AAGTTTGGATTCGCTGATG
GTAAGTTGCGGTTAATAGTCGTTAATCGATCTCTTATTAACAGTTCACAGCTCTCTCGTAACTTGCACCTTTGGCAACAGCCAGCCCGGACGACAAAACTC
GGCCGAATGGATCCGAACAGCTTTCCACGACGCCGTCACACACGATGCCAAGGCCGGCACTGGAGGTCTTGACGCCTCCATCTTCTGGGAGACCACTCGTGCTGAGAACGCTGGTAAAGC
TTGGGACAACACTTTCAGCTTTTTCGACGGTTTCTACAACCAGCGTGCCAGTGCTGCTGATCTCATCGCCCTCGGCACCGTTGTTGCCACCGGAGGATGCTACGGCCCCGACGTCCCTTT
CCGAGCTGGCCGTATTGATGCCGGGAAGCCTGGACCTACCGGTGTCCCTGAGCCCTCCACCAACTTGAAGGAGACCTTTGCCGCTTTCCAAAAGGCTGGCTTCACCAAGGAGGACATGAC
TGCTATGGTTGCTTGTGGCCACGCCCTCGGTGGTGTTCACAGCGTCGACTTCCCTGATGTCACTGGCATCAAGGCCGACCCCAACAACGACACATCCGTGCCTTTCCAGAAGGACATCTC
TAGCTTCCACAACGGTGTCGTCACCGAGTACCTCGACGGAACTACCAAGAACCCCCTCGTTGTTGCCAAGAACAACACCCTCAACTCCGACAAGCGCATCTTCGACAACGACCGTGCTAC
CATGAAGAAGCTCTCCACCAAGCAGGGCTTTAACACCATGTGTGCCGATATCTTTGCTCGCATGATCGACACTGTCCCCAAGAGCGTGCAGCTCAGCGATGTCATCTCCCCCTACGACGT
CAAGCCTTATGTTACGGAGCTTTCTCTCAACAGCAAGGGCAAGATCGTCTTCAAGGGTTCCGTCCGCCTCATGACCACCAACAAGATCCGTGATGGTGATGATCTTATCGTCGAGCTTGT
CTACATGGGCCACAACGGCAAGAAGACCACCGTTCCCACTAACAGGGCCATGTGGCGGTCAGGTGCCACTTTCGGCTCTGGCCAGCAGTTTGTCAACTTTGAGTTCGACACCACCATTGA
CGCCAAGAACGGTATCACCAAGTTCTGGATCAAGGAGACCAAGAAGTCTACCAAGGTCAGCAAGTCCCACGACAACCAAGGCACCCACGGCTACAAAGTCGACGATACCGTCCTGTACCA
GATCTCTGACTCCTGCCTTGCCGCCGACCAGCTGCCTGGCGCTCCCATGACCATCGCCGCCGTTGTCCGTGATAGCCAGGCAAAGAACGCTCTGACCCTCAAGGCTGTTGACAGGGTTGA
CCAAAAGGGAACTATTGTTCCCAAGCTCCAGACCAAGGTTGTCTCATTCAAGGCCACTGGCAAGAAGGCCAACGGTTACACCGCCTTCAAGGCCCAGACAAAGATCAACAACAACAACAT
CCGGTTCGACATTGCTCTTGCCGGAAGCCCTACTGCTGGCGTGCAGTTCCAGGCAGTTATTGCCATTCCCACTGGCTCTTGCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGGCCCTTCCACTGTCGCTATTGCTCTCGTTCCCTTCACAGCTGCCAAGCAGCTTGTCTGGCCCTCAAAGTTTGATTACCTTGAGGATCTCCAGTACAACCAGGACGGATACAAC
AAGTTTGGATTCGCTGATG
CTCTCGTAACTTGCACCTTTGGCAACAGCCAGCCCGGACGACAAAACTCGGCCGAATGGATCCGAACAGCTTTCCACGACGCCGTCACACACGATGCCAAG
GCCGGCACTGGAGGTCTTGACGCCTCCATCTTCTGGGAGACCACTCGTGCTGAGAACGCTGGTAAAGCTTGGGACAACACTTTCAGCTTTTTCGACGGTTTCTACAACCAGCGTGCCAGT
GCTGCTGATCTCATCGCCCTCGGCACCGTTGTTGCCACCGGAGGATGCTACGGCCCCGACGTCCCTTTCCGAGCTGGCCGTATTGATGCCGGGAAGCCTGGACCTACCGGTGTCCCTGAG
CCCTCCACCAACTTGAAGGAGACCTTTGCCGCTTTCCAAAAGGCTGGCTTCACCAAGGAGGACATGACTGCTATGGTTGCTTGTGGCCACGCCCTCGGTGGTGTTCACAGCGTCGACTTC
CCTGATGTCACTGGCATCAAGGCCGACCCCAACAACGACACATCCGTGCCTTTCCAGAAGGACATCTCTAGCTTCCACAACGGTGTCGTCACCGAGTACCTCGACGGAACTACCAAGAAC
CCCCTCGTTGTTGCCAAGAACAACACCCTCAACTCCGACAAGCGCATCTTCGACAACGACCGTGCTACCATGAAGAAGCTCTCCACCAAGCAGGGCTTTAACACCATGTGTGCCGATATC
TTTGCTCGCATGATCGACACTGTCCCCAAGAGCGTGCAGCTCAGCGATGTCATCTCCCCCTACGACGTCAAGCCTTATGTTACGGAGCTTTCTCTCAACAGCAAGGGCAAGATCGTCTTC
AAGGGTTCCGTCCGCCTCATGACCACCAACAAGATCCGTGATGGTGATGATCTTATCGTCGAGCTTGTCTACATGGGCCACAACGGCAAGAAGACCACCGTTCCCACTAACAGGGCCATG
TGGCGGTCAGGTGCCACTTTCGGCTCTGGCCAGCAGTTTGTCAACTTTGAGTTCGACACCACCATTGACGCCAAGAACGGTATCACCAAGTTCTGGATCAAGGAGACCAAGAAGTCTACC
AAGGTCAGCAAGTCCCACGACAACCAAGGCACCCACGGCTACAAAGTCGACGATACCGTCCTGTACCAGATCTCTGACTCCTGCCTTGCCGCCGACCAGCTGCCTGGCGCTCCCATGACC
ATCGCCGCCGTTGTCCGTGATAGCCAGGCAAAGAACGCTCTGACCCTCAAGGCTGTTGACAGGGTTGACCAAAAGGGAACTATTGTTCCCAAGCTCCAGACCAAGGTTGTCTCATTCAAG
GCCACTGGCAAGAAGGCCAACGGTTACACCGCCTTCAAGGCCCAGACAAAGATCAACAACAACAACATCCGGTTCGACATTGCTCTTGCCGGAAGCCCTACTGCTGGCGTGCAGTTCCAG
GCAGTTATTGCCATTCCCACTGGCTCTTGCAATTAG

Retrieve as FASTA