Entry information : Aeu2CysPrx02_201684 (g2529.t1 / Ae201684_2529.1)
Entry ID 11632
Creation 2013-02-08 (Christophe Dunand)
Last sequence changes 2014-03-12 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-13 (Christophe Dunand)
Peroxidase information: Aeu2CysPrx02_201684 (g2529.t1 / Ae201684_2529.1)
Name (synonym) Aeu2CysPrx02_201684 (g2529.t1 / Ae201684_2529.1)
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Saprolegniaceae Aphanomyces
Organism Aphanomyces euteiches    [TaxId: 100861 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Aeu2CysPrx02_201684
start..stop
S start..stop
Sdic2CysPrx02 356 8e-126 46..246 62..262
Spur2CysPrx03 247 9e-83 39..242 57..261
Egra2CysPrx01 244 3e-82 44..245 23..221
Agod2CysPrx01 243 6e-82 49..244 7..195
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 126778..127113 336 N° 2 127156..127566 411  
join(126778..127113,127156..127566)


exon

Literature and cross-references Aeu2CysPrx02_201684 (g2529.t1 / Ae201684_2529.1)
Protein sequence: Aeu2CysPrx02_201684 (g2529.t1 / Ae201684_2529.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   249 (227)
PWM (Da):   %s   27266.86 (24992.6) Transmb domain:   %s   i5-22o
PI (pH):   %s   6.12 (5.29) Peptide Signal:   %s   cut: 22 range:22-248
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIGRFFGAIALLACVFAVVSAADFKPAPAPSGSSFAPIWNYGGRPLSPRKPAPDFTNVNAVVDEKFTKISLNDYKGKWLVIFFYPFDFTFVCPTEIISFSDSIEQFRAINAEVIAVSTDSHHTHLAWIKTPRDKGGLGNMDIPILADISKQISANYGVLINDPSDDMFGAALRGLFIIDPQGIVRSIQINDDQVGRSVDETLRILKAFQYAMAHPGEVCPANWKPGSKTIKADQEAKYDFFDAAYGKH*

Retrieve as FASTA  
Remarks Complete sequence from genomic. scaffold5
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGGCCGTTTCTTCGGAGCGATTGCCCTCCTTGCTTGCGTTTTTGCGGTTGTCAGCGCTGCGGACTTCAAACCTGCACCTGCACCTTCTGGAAGTAGTTTCGCTCCAATTTGGAAT
TACGGGGGTCGCCCTCTGTCTCCACGCAAGCCAGCACCAGATTTTACGAATGTGAATGCTGTCGTGGACGAGAAGTTCACCAAGATTTCGCTCAACGACTACAAGGGCAAGTGGCTCGTG
ATCTTCTTCTACCCATTTGACTTCACATTCGTGTGCCCAACGGAAATCATCAGCTTCAGTGACTCGATCGAACAATTCCGAGCCATCAACGCTGAG
GTTTGAATCTTTGTTTGAGCTTGA
TCGTTGATGGTGTCTTAGGTTATTGCTGTCTCCACTGACTCGCATCACACACACTTGGCATGGATCAAGACTCCTCGTGACAAGGGTGGCTTGGGCAACATGGATATCCCTATCTTGGCT
GATATCAGCAAACAAATCTCGGCGAACTATGGTGTGCTCATCAACGACCCATCAGACGACATGTTTGGTGCAGCCTTGCGTGGGCTCTTCATCATTGACCCCCAAGGCATCGTGCGTTCG
ATTCAAATCAACGACGACCAAGTGGGACGCAGCGTCGATGAAACTTTGCGTATCCTCAAGGCCTTCCAATACGCCATGGCTCATCCTGGTGAAGTTTGCCCAGCCAACTGGAAGCCAGGT
TCCAAGACGATCAAGGCTGACCAAGAGGCCAAGTACGACTTCTTCGATGCTGCTTATGGCAAGCATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATCGGCCGTTTCTTCGGAGCGATTGCCCTCCTTGCTTGCGTTTTTGCGGTTGTCAGCGCTGCGGACTTCAAACCTGCACCTGCACCTTCTGGAAGTAGTTTCGCTCCAATTTGGAAT
TACGGGGGTCGCCCTCTGTCTCCACGCAAGCCAGCACCAGATTTTACGAATGTGAATGCTGTCGTGGACGAGAAGTTCACCAAGATTTCGCTCAACGACTACAAGGGCAAGTGGCTCGTG
ATCTTCTTCTACCCATTTGACTTCACATTCGTGTGCCCAACGGAAATCATCAGCTTCAGTGACTCGATCGAACAATTCCGAGCCATCAACGCTGAG
GTTATTGCTGTCTCCACTGACTCG
CATCACACACACTTGGCATGGATCAAGACTCCTCGTGACAAGGGTGGCTTGGGCAACATGGATATCCCTATCTTGGCTGATATCAGCAAACAAATCTCGGCGAACTATGGTGTGCTCATC
AACGACCCATCAGACGACATGTTTGGTGCAGCCTTGCGTGGGCTCTTCATCATTGACCCCCAAGGCATCGTGCGTTCGATTCAAATCAACGACGACCAAGTGGGACGCAGCGTCGATGAA
ACTTTGCGTATCCTCAAGGCCTTCCAATACGCCATGGCTCATCCTGGTGAAGTTTGCCCAGCCAACTGGAAGCCAGGTTCCAAGACGATCAAGGCTGACCAAGAGGCCAAGTACGACTTC
TTCGATGCTGCTTATGGCAAGCATTAA

Retrieve as FASTA