Entry information : Aeu1CysPrx02_201684 (g3481.t1 / Ae201684_3481.1)
Entry ID 11633
Creation 2013-02-08 (Christophe Dunand)
Last sequence changes 2014-03-13 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-03-13 (Christophe Dunand)
Peroxidase information: Aeu1CysPrx02_201684 (g3481.t1 / Ae201684_3481.1)
Name (synonym) Aeu1CysPrx02_201684 (g3481.t1 / Ae201684_3481.1)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Saprolegniaceae Aphanomyces
Organism Aphanomyces euteiches    [TaxId: 100861 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Aeu1CysPrx02_201684
start..stop
S start..stop
Sdic1CysPrx01 377 7e-135 1..225 1..225
Spar1CysPrx01 372 6e-133 1..225 1..225
Pul1CysPrx01 321 5e-113 6..225 8..227
Pi1CysPrx01 288 7e-100 8..224 6..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1196913..1197065 153 N° 2 1196791..1196869 79 N° 3 1196502..1196746 245 N° 4 1196264..1196464 201
complement(join(1196264..1196464,1196502..1196746,1196791..1196869,1196913..1197 065))


exon

Literature and cross-references Aeu1CysPrx02_201684 (g3481.t1 / Ae201684_3481.1)
Protein sequence: Aeu1CysPrx02_201684 (g3481.t1 / Ae201684_3481.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226
PWM (Da):   %s   25402.99  
PI (pH):   %s   5.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAPSFQVGSKIPKMIGMTQMGSIKLHDYIDGAWALLLTFPQDFHPVWMTELGMLTKLKPQFDARNCRVLGLSISSLKQQARFIDDVNETQDVQINFPIFADESGELSRKLGLIKSSAPGDGFEHFRLPYSAAIILDIDMTARFVFYYPISIGRNLYELIRVLDGLQLAMYNQVVLPTNWKVNDDVFIEPDISSDAAKSLFPHGYHEIKPYFRITPSPAITEEQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) Scaffold6
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCAGCACCATCGTTCCAAGTTGGAAGCAAAATACCCAAAATGATTGGGATGACACAAATGGGCTCTATCAAATTGCACGATTATATTGACGGGGCTTGGGCGCTGCTATTAACA
TTCCCCCAGGACTTTCACCCGGTTTGGATGACT
GTATGCAAGCCGATGGTGTCGTCAAATGAAGTTACTGTGATAGGAACTTGGTATGCTCACGAAATTGAAGCCACAATTTGATGCTCG
GAATTGTCGTGTCTTGGGCTTGAGCATCAGTTCGC
GTATGTAGCGCAGGTTATGTTTACTCACTACGTTTTGATGGTAGTGAAGCAGCAAGCTCGATTTATTGATGATGTCAACGAAACG
CAGGATGTCCAAATCAATTTCCCAATATTTGCAGACGAATCTGGAGAACTCTCGCGCAAACTAGGGTTGATAAAGTCATCGGCACCGGGCGATGGATTTGAGCACTTCCGATTACCATAC
AGCGCGGCAATTATTCTCGACATAGATATGACCGCTCGATTTGTTTTCTACTATCCGATCTCGATCGGCCGCAATCTTTACGAA
GTATGTTATTTCCATTGTGCTGATGACTTGCATATA
GTTAATTCGGGTCTTGGACGGGTTACAACTGGCAATGTATAACCAAGTGGTCCTTCCAACAAATTGGAAAGTCAACGACGACGTCTTCATTGAGCCAGACATCTCTTCAGATGCAGCTAA
GTCGTTATTCCCCCATGGCTATCATGAAATTAAGCCCTACTTCCGCATCACACCTTCTCCGGCAATAACGGAAGAACAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCAGCACCATCGTTCCAAGTTGGAAGCAAAATACCCAAAATGATTGGGATGACACAAATGGGCTCTATCAAATTGCACGATTATATTGACGGGGCTTGGGCGCTGCTATTAACA
TTCCCCCAGGACTTTCACCCGGTTTGGATGACT
GAACTTGGTATGCTCACGAAATTGAAGCCACAATTTGATGCTCGGAATTGTCGTGTCTTGGGCTTGAGCATCAGTTCGCTGAAGCAG
CAAGCTCGATTTATTGATGATGTCAACGAAACGCAGGATGTCCAAATCAATTTCCCAATATTTGCAGACGAATCTGGAGAACTCTCGCGCAAACTAGGGTTGATAAAGTCATCGGCACCG
GGCGATGGATTTGAGCACTTCCGATTACCATACAGCGCGGCAATTATTCTCGACATAGATATGACCGCTCGATTTGTTTTCTACTATCCGATCTCGATCGGCCGCAATCTTTACGAA
TTA
ATTCGGGTCTTGGACGGGTTACAACTGGCAATGTATAACCAAGTGGTCCTTCCAACAAATTGGAAAGTCAACGACGACGTCTTCATTGAGCCAGACATCTCTTCAGATGCAGCTAAGTCG
TTATTCCCCCATGGCTATCATGAAATTAAGCCCTACTTCCGCATCACACCTTCTCCGGCAATAACGGAAGAACAATAA

Retrieve as FASTA