Entry information : AeuHalPrx01_201684 (g15565.t1 / Ae201684_15565.1)
Entry ID 11635
Creation 2013-02-08 (Christophe Dunand)
Last sequence changes 2014-03-31 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-10-15 (Christophe Dunand)
Peroxidase information: AeuHalPrx01_201684 (g15565.t1 / Ae201684_15565.1)
Name (synonym) AeuHalPrx01_201684 (g15565.t1 / Ae201684_15565.1)
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Saprolegniaceae Aphanomyces
Organism Aphanomyces euteiches    [TaxId: 100861 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AeuHalPrx01_201684
start..stop
S start..stop
MgrHalPrx01 110 1.41e-29 24..217 52..245
SAcoHalPrx02 110 3.31e-29 22..200 69..245
AorHalPrx03 103 5.4e-27 24..208 46..252
PnoHalPrx04 103 5.69e-27 15..206 20..214
Gene structure Fichier Exons


exon

Literature and cross-references AeuHalPrx01_201684 (g15565.t1 / Ae201684_15565.1)
Protein sequence: AeuHalPrx01_201684 (g15565.t1 / Ae201684_15565.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   236
PWM (Da):   %s   26046.34 Transmb domain:   %s   i294-313o372-394i433-455o475-497i665-682o
PI (pH):   %s   4.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGCAHSTPATNANLFTNWTATEADNASPCPFLNAIANHGLVPRTGITFDKLKEALANLQLDERLQKVLTGSIAQELATEVDGVKQLSLSQLSGHNAIEHDASLTRQDAALGDSVKLDPEL
LSALVALSSDGQYLTKAHLGHYRSIREQHSKTHNSSYTFDSKQQAFAYLEAALLLLILRDSTGNIRIDWLKMVFEQEKLPIELGWELRSITTEEVLVAMGDLKGEKFEETILEQLY*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). scaffold52:52606..53363
DNA
Send to BLAST
CDS
Send to BLAST