Entry information : AeuKat01-1_201684 ( g109.t1 / Ae201684_109.1)
Entry ID 11636
Creation 2013-02-08 (Christophe Dunand)
Last sequence changes 2014-03-12 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-17 (Christophe Dunand)
Peroxidase information: AeuKat01-1_201684 ( g109.t1 / Ae201684_109.1)
Name (synonym) AeuKat01-1_201684 ( g109.t1 / Ae201684_109.1)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Saprolegniaceae Aphanomyces
Organism Aphanomyces euteiches    [TaxId: 100861 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AeuKat01-1_201684
start..stop
S start..stop
AeuKat01-2_201684 1042 0 5..524 6..525
AeuKat02_Ae201684 738 0 5..490 3..491
PiKat01 733 0 1..524 1..522
PcapKat03 723 0 1..524 1..522
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 284478..285785 1308 N° 2 285837..286103 267  
join(284478..285785,285837..286103)


exon

Literature and cross-references AeuKat01-1_201684 ( g109.t1 / Ae201684_109.1)
Cluster/Prediction ref. AphanoDB:   217151
Protein sequence: AeuKat01-1_201684 ( g109.t1 / Ae201684_109.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   525
PWM (Da):   %s   58716.54  
PI (pH):   %s   7.13
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATNTKVATTSNGAPLPNNGLTASETVGPHGPIVLQDFALLDHLAHFDRERIPERVVHAKGAGAFGYFEVTHDFTSVCSAKFLSSVGKRTPVALRFSTVGGELGSADTVRDPRGFAVKFYTEEGNWDLVGNNTPIFFLRDPILFPSFIHTQKRNPATHLKDADMFWDFISLRPETTHQVSFLFSDRGIPDGYRHLNGYGSHTFENVNAQGVVSYVKYHFKTDQGIRNLPVDVADKLAGTNPDYAIQDLYEAIARKEYPTWTLYIQVMTQAQAEQHLAQGFNPFDVTKVWSHKTYPLKEVGKLVLNRNPANYFSDVEQLAFSPAHFVPGIQPSPDKMLQGRLFSYSDTHRHRLGPNYQQIPVNQPVQSQPKNYQRDGFMTVNGNQGGAPNYFPNSFNGPDYLANVPEPAKQVSQTVIRRYSSKDEDNFTQAGEFFRNVLTEDERTRLVNNIASNLINAKPSIQARAVENFTAADIDYGGRINQKLKELRDTIEKEAPKTAAAPLNPPRNNTYKPLDPEEDALPRF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (scaffold1, 1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACCAACACCAAAGTCGCGACGACCAGCAACGGCGCTCCTCTGCCCAACAATGGACTCACTGCCTCGGAAACCGTCGGCCCCCATGGCCCCATCGTCCTCCAAGACTTTGCTCTC
TTGGATCACTTGGCCCACTTTGACCGTGAACGCATCCCCGAGCGTGTGGTCCACGCAAAGGGAGCTGGCGCCTTCGGGTACTTTGAAGTGACCCACGACTTCACGTCGGTGTGCAGTGCC
AAGTTCCTCTCGTCCGTTGGCAAGCGTACACCTGTTGCTCTCCGTTTCTCGACGGTCGGTGGTGAACTCGGCAGTGCGGATACCGTTCGCGATCCCCGCGGATTTGCCGTCAAGTTTTAC
ACGGAAGAAGGCAACTGGGACTTGGTGGGTAACAACACGCCCATCTTCTTCCTCCGAGACCCCATTCTCTTCCCGAGCTTCATTCACACGCAAAAGCGCAACCCCGCGACGCACTTGAAG
GATGCCGACATGTTCTGGGACTTCATCTCTCTCCGTCCTGAAACCACGCATCAAGTGTCGTTCCTCTTCTCGGACCGCGGCATTCCTGATGGTTACCGTCACTTGAACGGCTACGGCAGC
CACACGTTCGAGAACGTGAATGCTCAAGGCGTGGTGTCGTACGTCAAGTACCATTTCAAGACCGACCAAGGCATTCGCAACTTGCCCGTGGATGTTGCTGACAAATTGGCCGGCACCAAC
CCAGACTACGCGATCCAGGACTTGTACGAAGCCATCGCTCGCAAGGAATACCCAACATGGACGCTGTACATCCAAGTAATGACGCAAGCTCAAGCCGAACAACACTTGGCTCAAGGCTTC
AACCCGTTTGATGTGACCAAGGTGTGGTCGCACAAGACGTACCCGTTGAAGGAAGTCGGCAAGCTCGTCCTCAACCGCAATCCCGCGAACTACTTCAGCGACGTGGAGCAATTGGCGTTC
TCCCCTGCGCACTTTGTTCCTGGCATCCAACCTTCGCCTGACAAGATGCTTCAAGGCCGTCTCTTCTCCTACTCGGACACGCATCGCCACCGTCTCGGCCCGAACTACCAACAGATCCCA
GTGAATCAACCAGTGCAGAGCCAACCCAAGAACTATCAACGTGATGGTTTCATGACCGTGAATGGCAACCAAGGCGGCGCGCCAAATTACTTCCCCAACAGCTTCAACGGACCTGACTAC
TTGGCCAACGTCCCTGAGCCTGCTAAGCAAGTGAGCCAGACGGTCATCCGTCGCTACAGCTCGAAGGACGAAGACAACTTCACCCAAGCTGGCGAATTCTTCCGCAAT
GTAAGGCGCATC
GCATCTCGACGCCGCATACTGACATGTTCTCTGGTCTAGGTGCTCACGGAAGACGAACGCACTCGTTTGGTGAACAACATCGCGTCCAACTTGATCAACGCCAAGCCATCCATTCAAGCC
CGCGCAGTGGAGAACTTCACCGCCGCCGACATTGACTACGGTGGACGCATCAACCAAAAGTTGAAAGAGTTGCGCGACACGATCGAGAAGGAAGCCCCCAAGACGGCCGCTGCTCCTCTC
AATCCTCCACGTAACAACACTTACAAGCCGCTGGATCCTGAAGAGGATGCGCTTCCGCGTTTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACCAACACCAAAGTCGCGACGACCAGCAACGGCGCTCCTCTGCCCAACAATGGACTCACTGCCTCGGAAACCGTCGGCCCCCATGGCCCCATCGTCCTCCAAGACTTTGCTCTC
TTGGATCACTTGGCCCACTTTGACCGTGAACGCATCCCCGAGCGTGTGGTCCACGCAAAGGGAGCTGGCGCCTTCGGGTACTTTGAAGTGACCCACGACTTCACGTCGGTGTGCAGTGCC
AAGTTCCTCTCGTCCGTTGGCAAGCGTACACCTGTTGCTCTCCGTTTCTCGACGGTCGGTGGTGAACTCGGCAGTGCGGATACCGTTCGCGATCCCCGCGGATTTGCCGTCAAGTTTTAC
ACGGAAGAAGGCAACTGGGACTTGGTGGGTAACAACACGCCCATCTTCTTCCTCCGAGACCCCATTCTCTTCCCGAGCTTCATTCACACGCAAAAGCGCAACCCCGCGACGCACTTGAAG
GATGCCGACATGTTCTGGGACTTCATCTCTCTCCGTCCTGAAACCACGCATCAAGTGTCGTTCCTCTTCTCGGACCGCGGCATTCCTGATGGTTACCGTCACTTGAACGGCTACGGCAGC
CACACGTTCGAGAACGTGAATGCTCAAGGCGTGGTGTCGTACGTCAAGTACCATTTCAAGACCGACCAAGGCATTCGCAACTTGCCCGTGGATGTTGCTGACAAATTGGCCGGCACCAAC
CCAGACTACGCGATCCAGGACTTGTACGAAGCCATCGCTCGCAAGGAATACCCAACATGGACGCTGTACATCCAAGTAATGACGCAAGCTCAAGCCGAACAACACTTGGCTCAAGGCTTC
AACCCGTTTGATGTGACCAAGGTGTGGTCGCACAAGACGTACCCGTTGAAGGAAGTCGGCAAGCTCGTCCTCAACCGCAATCCCGCGAACTACTTCAGCGACGTGGAGCAATTGGCGTTC
TCCCCTGCGCACTTTGTTCCTGGCATCCAACCTTCGCCTGACAAGATGCTTCAAGGCCGTCTCTTCTCCTACTCGGACACGCATCGCCACCGTCTCGGCCCGAACTACCAACAGATCCCA
GTGAATCAACCAGTGCAGAGCCAACCCAAGAACTATCAACGTGATGGTTTCATGACCGTGAATGGCAACCAAGGCGGCGCGCCAAATTACTTCCCCAACAGCTTCAACGGACCTGACTAC
TTGGCCAACGTCCCTGAGCCTGCTAAGCAAGTGAGCCAGACGGTCATCCGTCGCTACAGCTCGAAGGACGAAGACAACTTCACCCAAGCTGGCGAATTCTTCCGCAAT
GTGCTCACGGAA
GACGAACGCACTCGTTTGGTGAACAACATCGCGTCCAACTTGATCAACGCCAAGCCATCCATTCAAGCCCGCGCAGTGGAGAACTTCACCGCCGCCGACATTGACTACGGTGGACGCATC
AACCAAAAGTTGAAAGAGTTGCGCGACACGATCGAGAAGGAAGCCCCCAAGACGGCCGCTGCTCCTCTCAATCCTCCACGTAACAACACTTACAAGCCGCTGGATCCTGAAGAGGATGCG
CTTCCGCGTTTTTAA

Retrieve as FASTA