Entry information : Athi2CysPrx01
Entry ID 11667
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: Athi2CysPrx01
Name Athi2CysPrx01
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita thiersii    [TaxId: 235537 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Athi2CysPrx01
start..stop
S start..stop
Slut2CysPrx01 358 7.49e-128 1..218 1..216
Sbre2CysPrx01 357 1.99e-127 1..216 1..214
Lbi2CysPrx 352 2.18e-125 1..217 1..219
Ppl2CysPrx01-1A 350 8.5e-125 1..217 1..210
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11667' 'complement(join(441115..441279,441339..441417,441468..441666,441722..441783,441832..441855,441907..441930,441985..442085))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 441985..442085 99 N° 2 441907..441930 22 N° 3 441832..441855 22 N° 4 441722..441783 60
N° 5 441468..441666 197 N° 6 441339..441417 77 N° 7 441115..441279 163  
complement(join(441115..441279,441339..441417,441468..441666,441722..441783,4418 32..441855,441907..441930,441985..442085))


exon

Literature and cross-references Athi2CysPrx01
DNA ref. JGI genome:   scaffold_5 (442085..441115)
Cluster/Prediction ref. JGI gene:   79078
Protein sequence: Athi2CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   217
PWM (Da):   %s   23549.19  
PI (pH):   %s   5.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVAVVQRPAPAFSATAVIEGQFKEIALSDFLGQWVVLFFYPLDFTFVCPTEILAFNDALPKFKDLGVAILGVSTDSQFSHLAWASQPRKQGGLGPDLTLPLIADKNMEISRDYGVLIEDA
GIALRGLFLIDPKGTLRQITINDLPVGRSVEETIRLIKAFKFTDEHGEVCPANWTEGSKTIKADPKGSLEYFASSNGATNGTNGEANGSSKKRPRTD*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGCCGTTGTTCAACGCCCTGCTCCTGCCTTCAGCGCCACTGCAGTTATTGAAGGACAGTTCAAGGAAATCGCTTTGTCGGATTTCCTTGGTCAATGGTGCGTGTTGAATTCTTTG
CAAGTTGGGTGGTTTGGTTGCTCAAGTTGTTCTAGGGGGTTGTTCTTTTTTTCTACCCTCTGTAGGTCTTATTACTGAGCTAGTGTATTATGGTTGTACTCATTACCACTAGCGCGACTT
CACCTTTGTCTGCCCAAC
GTGAGTAGGCGTCCTGTGTCATTGATAATTAGACTGACCACTTAACAGCGCGAAATTTTGGCTTTTAATGACGCTCTACCAAAGTTCAAGGATTTAGGTGTG
GCCATTCTTG
GTAAGCTTCTAGTATCTTGAAGTGTGCCCCCAATCATTCACGTAATGCTTGACAGGTGTGTTTCTACTGACTCTCAGTTTTCCCACCTTGCCTGGGCTTCTCAACCAAGG
AAGCAGGGCGGTCTTGGTCCCGACCTCACACTTCCCCTCATTGCTGACAAGAACATGGAAATTTCCCGGGACTATGGTGTTTTGATTGAAGATGCTGGCATTGCTTTGCGTGGGTTATTC
TTGATTGATCCCAAGGGTACACTTAG
GTGAGGAGCTAAATCAAATCAAATACCCAATAATTGCTAAATTCTGGTAGGCGCAAATAACCATTAATGATCTTCCTGTTGGGCGATCGGTTGA
AGAAACTATCCGTCTGATCAAGGCTTTCAAGTTCACT
GTAAGTCTTCTAAGAATAAATGTGGCGTGGAATCTGTATCTGATATTGTGTGGCGCAAGGAGATGAGCATGGAGAGGTTTGTC
CAGCAAACTGGACTGAGGGCTCCAAGACTATCAAAGCTGATCCCAAGGGCTCTTTGGAGTACTTTGCATCGAGCAATGGTGCTACCAACGGTACCAATGGCGAAGCAAATGGCTCTTCAA
AGAAGCGGCCTCGTACTGACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTGCCGTTGTTCAACGCCCTGCTCCTGCCTTCAGCGCCACTGCAGTTATTGAAGGACAGTTCAAGGAAATCGCTTTGTCGGATTTCCTTGGTCAATGGGTTGTTCTTTTTTTCTAC
CCTCT
CGACTTCACCTTTGTCTGCCCAACCGAAATTTTGGCTTTTAATGACGCTCTACCAAAGTTCAAGGATTTAGGTGTGGCCATTCTTGGTGTTTCTACTGACTCTCAGTTTTCCCAC
CTTGCCTGGGCTTCTCAACCAAGGAAGCAGGGCGGTCTTGGTCCCGACCTCACACTTCCCCTCATTGCTGACAAGAACATGGAAATTTCCCGGGACTATGGTGTTTTGATTGAAGATGCT
GGCATTGCTTTGCGTGGGTTATTCTTGATTGATCCCAAGGGTACACTTAG
GCAAATAACCATTAATGATCTTCCTGTTGGGCGATCGGTTGAAGAAACTATCCGTCTGATCAAGGCTTTC
AAGTTCACT
GATGAGCATGGAGAGGTTTGTCCAGCAAACTGGACTGAGGGCTCCAAGACTATCAAAGCTGATCCCAAGGGCTCTTTGGAGTACTTTGCATCGAGCAATGGTGCTACCAAC
GGTACCAATGGCGAAGCAAATGGCTCTTCAAAGAAGCGGCCTCGTACTGACTGA

Retrieve as FASTA