Entry information : AmusPrxII
Entry ID 11671
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-26 (Catherine Mathe (Scipio))
Peroxidase information: AmusPrxII
Name AmusPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita muscaria    [TaxId: 41956 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmusPrxII
start..stop
S start..stop
SbrePrxII01 253 1.34e-87 4..171 6..173
AthiPrxII 249 4.71e-86 1..171 1..173
SlutPrxII01 248 6.61e-86 4..170 6..172
LbiPrxII 245 1.2e-84 3..170 2..169
Gene structure Fichier Exons


exon

Literature and cross-references AmusPrxII
DNA ref. JGI genome:   scaffold_114 (38142..37365)
Cluster/Prediction ref. JGI gene:   194042
Protein sequence: AmusPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   18140.48  
PI (pH):   %s   6.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATIHVGDIIKPGKFEHIPYGPELEDHAACGFPLTLSTDEWKGKKVVIFSVPGAFTPTCHADHLPGYLKRYDEFKAKGVDVVAVVAANDPFVMSGWGRIQGLKDKILSLSDPLAQWSASL
GLSFEPNKHGLGVRTARYALVLDDLVVKYIGVEPAPGVTVSGADAVLGAL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
CDS
Send to BLAST