Entry information : BdotAPx-CcP02 (BdotHyBpox2)
Entry ID 11701
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2017-03-07 (Marcel Zamocky)
Peroxidase information: BdotAPx-CcP02 (BdotHyBpox2)
Name (synonym) BdotAPx-CcP02 (BdotHyBpox2)
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Botryosphaeriaceae Botryosphaeria
Organism Botryosphaeria dothidea    [TaxId: 55169 ]
Cellular localisation Secreted
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BdotAPx-CcP02
start..stop
S start..stop
HC14APx-CcP02 559 0 1..533 1..545
CgloAPx-CcP03_ST23 525 0 1..526 1..533
CgloAPx-CcP03_Naragc5 522 0 1..526 1..533
ApruAPx-CcP03 517 1.68e-180 1..533 1..537
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11701' 'join(15139..15280,15335..15733,15790..16850)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15139..15280 140 N° 2 15335..15733 397 N° 3 15790..16850 1059  
join(15139..15280,15335..15733,15790..16850)


exon

Literature and cross-references BdotAPx-CcP02 (BdotHyBpox2)
DNA ref. JGI genome:   NODE_791_length_50849_cov_60.732246 (15139..16850)
Cluster/Prediction ref. JGI gene:   13200
Protein sequence: BdotAPx-CcP02 (BdotHyBpox2)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   533 (514)
PWM (Da):   %s   57262.94 (55366.9)  
PI (pH):   %s   4.44 (4.41) Peptide Signal:   %s   cut: 20 range:20-533
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKTSALAGLSLLQILPSTAEYVWPSKYDYLEDVLYLHSGYIREGF
VD
GVNPCSFSSAGEGRQTAAEWVRTAYHDMATHDAAAGTGGLDASIMFETERDENVGDAFNGTFGFISNYYTIRASAADLLALSTVVAIGHCSGPQIPFRAGRVDATEAGPLGVPKPDQDID
THTQIFAKAGFNT
SDMIKMVACGHTLGGVHGKDFPEITFSDTDTNFEHFEGNNSFSSFDNTVVTEYLDGSTPNMLVAGQNDTTNSDKRVFGADNNTTMKALADPATFQSSCEDILGRMID
TVPSDITLTDPFTPAPIKPYITTFALANATHLTLTGRIRIATDFDSYADQAIHLTYTPRTAQNSSTPLNTTIPTTRAMWKGGTTSGIFRELFAWHEFSVTLPTASSIASFNVTVVRTSTG
EHQTYDNAGAGGYALDDALLYQPAQSCRKDGATTITAAVRKEVLSGGGKVGVEMVVKRPRQGVFLPALEVETWEGAAGKEVGEWVLVEVKGELEADSWSTTFDVVAGERKVEFQRTNALE
EECAVL

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). No EST yet.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAACTTCCGCGCTTGCAGGGCTCAGCCTGCTGCAGATTCTACCATCTACTGCCGAATACGTTTGGCCATCTAAATATGACTACCTAGAAGATGTGCTTTACTTACATTCTGGTTAC
ATCCGAGAGGGTTTCGTCGATG
TGGTATGCGCAGCAATTGGGACTATCCTTGCGGTTTTTGAAACTCACGAACACCAGGAGTGAATCCCTGCTCATTCTCCTCCGCGGGAGAGGGCCGCC
AGACAGCCGCTGAATGGGTCCGCACCGCCTACCACGACATGGCCACTCACGATGCTGCTGCTGGCACCGGTGGTCTGGACGCATCCATCATGTTTGAAACCGAGAGAGACGAGAATGTGG
GGGACGCATTCAACGGAACATTTGGCTTCATTAGCAATTACTACACCATCAGAGCCTCAGCGGCCGATCTTCTGGCTCTATCCACCGTTGTTGCTATCGGGCACTGCAGCGGCCCCCAGA
TTCCCTTCCGTGCCGGACGTGTTGATGCTACTGAGGCTGGCCCCTTGGGTGTTCCCAAGCCAGATCAAGACATTGATACGCACACCCAAATCTTTGCCAAGGCAGGCTTCAATACCA
CAG
TGAGTTACGCAGACGTCATAGCTACCTTGTCAAATAGAAACACTGACAATTGTAGGTGACATGATCAAAATGGTAGCCTGCGGCCACACCCTCGGCGGCGTCCACGGCAAGGACTTCCCC
GAAATCACCTTCAGCGACACCGACACCAACTTCGAGCACTTCGAGGGCAACAACTCCTTCTCCAGCTTCGACAACACCGTCGTGACCGAGTACCTCGACGGCAGCACGCCCAACATGCTC
GTCGCCGGCCAAAACGACACCACCAACAGCGACAAGCGCGTCTTCGGCGCCGACAACAACACCACCATGAAGGCCCTCGCCGACCCGGCCACCTTCCAGTCCTCCTGTGAAGACATCCTC
GGCCGCATGATCGACACCGTCCCCTCCGACATCACCCTCACCGACCCCTTCACGCCCGCCCCCATCAAACCCTACATCACCACCTTCGCGCTCGCCAACGCCACCCACCTCACGCTGACC
GGCCGCATCCGCATCGCCACCGACTTCGACAGCTACGCCGACCAAGCCATCCACCTCACCTACACGCCGCGCACCGCTCAAAACTCCTCGACGCCCCTCAACACCACCATCCCCACCACC
CGCGCCATGTGGAAAGGCGGCACCACGAGCGGCATCTTCCGCGAGCTCTTCGCCTGGCACGAGTTCTCCGTGACCCTCCCGACCGCCTCCTCCATCGCCTCCTTTAACGTCACCGTCGTG
CGCACCTCGACCGGCGAGCACCAGACGTACGACAACGCCGGCGCCGGCGGCTACGCGCTCGACGACGCGCTGCTGTACCAGCCGGCGCAGTCGTGTCGGAAGGACGGCGCAACGACCATT
ACCGCGGCGGTGCGGAAGGAGGTGTTGAGCGGTGGCGGGAAGGTCGGGGTCGAGATGGTGGTGAAGAGGCCGCGGCAGGGCGTGTTTCTTCCGGCGTTGGAGGTTGAGACGTGGGAGGGT
GCGGCGGGGAAGGAGGTCGGCGAGTGGGTGCTTGTTGAGGTGAAGGGGGAGTTGGAGGCGGATAGTTGGAGCACGACGTTTGATGTTGTGGCGGGGGAGAGGAAGGTCGAGTTTCAGAGG
ACGAATGCGTTGGAGGAGGAGTGTGCGGTTTTGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAACTTCCGCGCTTGCAGGGCTCAGCCTGCTGCAGATTCTACCATCTACTGCCGAATACGTTTGGCCATCTAAATATGACTACCTAGAAGATGTGCTTTACTTACATTCTGGTTAC
ATCCGAGAGGGTTTCGTCGATG
GAGTGAATCCCTGCTCATTCTCCTCCGCGGGAGAGGGCCGCCAGACAGCCGCTGAATGGGTCCGCACCGCCTACCACGACATGGCCACTCACGATGCT
GCTGCTGGCACCGGTGGTCTGGACGCATCCATCATGTTTGAAACCGAGAGAGACGAGAATGTGGGGGACGCATTCAACGGAACATTTGGCTTCATTAGCAATTACTACACCATCAGAGCC
TCAGCGGCCGATCTTCTGGCTCTATCCACCGTTGTTGCTATCGGGCACTGCAGCGGCCCCCAGATTCCCTTCCGTGCCGGACGTGTTGATGCTACTGAGGCTGGCCCCTTGGGTGTTCCC
AAGCCAGATCAAGACATTGATACGCACACCCAAATCTTTGCCAAGGCAGGCTTCAATACCA
GTGACATGATCAAAATGGTAGCCTGCGGCCACACCCTCGGCGGCGTCCACGGCAAGGAC
TTCCCCGAAATCACCTTCAGCGACACCGACACCAACTTCGAGCACTTCGAGGGCAACAACTCCTTCTCCAGCTTCGACAACACCGTCGTGACCGAGTACCTCGACGGCAGCACGCCCAAC
ATGCTCGTCGCCGGCCAAAACGACACCACCAACAGCGACAAGCGCGTCTTCGGCGCCGACAACAACACCACCATGAAGGCCCTCGCCGACCCGGCCACCTTCCAGTCCTCCTGTGAAGAC
ATCCTCGGCCGCATGATCGACACCGTCCCCTCCGACATCACCCTCACCGACCCCTTCACGCCCGCCCCCATCAAACCCTACATCACCACCTTCGCGCTCGCCAACGCCACCCACCTCACG
CTGACCGGCCGCATCCGCATCGCCACCGACTTCGACAGCTACGCCGACCAAGCCATCCACCTCACCTACACGCCGCGCACCGCTCAAAACTCCTCGACGCCCCTCAACACCACCATCCCC
ACCACCCGCGCCATGTGGAAAGGCGGCACCACGAGCGGCATCTTCCGCGAGCTCTTCGCCTGGCACGAGTTCTCCGTGACCCTCCCGACCGCCTCCTCCATCGCCTCCTTTAACGTCACC
GTCGTGCGCACCTCGACCGGCGAGCACCAGACGTACGACAACGCCGGCGCCGGCGGCTACGCGCTCGACGACGCGCTGCTGTACCAGCCGGCGCAGTCGTGTCGGAAGGACGGCGCAACG
ACCATTACCGCGGCGGTGCGGAAGGAGGTGTTGAGCGGTGGCGGGAAGGTCGGGGTCGAGATGGTGGTGAAGAGGCCGCGGCAGGGCGTGTTTCTTCCGGCGTTGGAGGTTGAGACGTGG
GAGGGTGCGGCGGGGAAGGAGGTCGGCGAGTGGGTGCTTGTTGAGGTGAAGGGGGAGTTGGAGGCGGATAGTTGGAGCACGACGTTTGATGTTGTGGCGGGGGAGAGGAAGGTCGAGTTT
CAGAGGACGAATGCGTTGGAGGAGGAGTGTGCGGTTTTGTGA

Retrieve as FASTA