Entry information : SturCIIAB02
Entry ID 11712
Creation 2013-04-09 (Christophe Dunand)
Last sequence changes 2013-04-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-09-04 (Catherine Mathe (Scipio))
Peroxidase information: SturCIIAB02
Name SturCIIAB02
Class Asco Class II type B    [Orthogroup: CIIAB001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Setosphaeria
Organism Setosphaeria turcica    [TaxId: 93612 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SturCIIAB02
start..stop
S start..stop
Ssrc1lsm3aCIIAB06 280 9e-95 8..283 8..280
PtritCIIAB04 280 2e-94 1..293 1..291
ClunCIIAB02 273 1e-91 6..295 7..295
CheCIIAB03_C5 272 1e-91 1..293 1..292
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 362078..362752 675 N° 2 361786..361998 213  
complement(join(361786..361998,362078..362752))


exon

Literature and cross-references SturCIIAB02
DNA ref. JGI genome:   scaffold_11 (362752..361786)
Cluster/Prediction ref. JGI gene:   158705
Protein sequence: SturCIIAB02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   296 (276)
PWM (Da):   %s   32348.57 (30274.3)  
PI (pH):   %s   7.84 (7.55) Peptide Signal:   %s   cut: 20 range:20-295
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRFSPIPLLAVLAATPILAEELAPRYDACPPVWKDVVNYLKPKFSGCSRSAHKIIRAAFHDCINNGCDGSLALSDERTHPENQGLQETCELVVDLKKRFSVSAADAIQFGAALAIASCPLGPRVRALVGRHDHSQPAERFSVPSSRDSVNKILVAFDKHGLSPRDVVALLGIHSAAFQEFDIPSLGVVALDSTPYIDDMRYYQETIAGTAPHSLQSDRLMTKAPQTKDAFAEFASDAYAWNKAFVEAFGRLSTIGNEHVKFTDCSHLIPNSPPVPRKRQIQNLKFTQKLAEKFGV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTTTTCACCAATCCCCCTCCTCGCTGTGCTGGCAGCAACACCCATCTTAGCCGAAGAGCTCGCGCCGCGATATGATGCCTGTCCTCCTGTCTGGAAAGACGTTGTAAATTATCTC
AAGCCCAAATTCAGCGGTTGCTCTAGATCCGCCCACAAAATAATTCGCGCAGCGTTTCATGATTGCATCAACAATGGGTGTGACGGCAGCTTAGCCCTCAGTGATGAGCGCACCCATCCT
GAGAACCAGGGTCTTCAGGAGACTTGCGAACTGGTTGTGGATTTGAAGAAGCGATTCAGCGTCAGTGCGGCCGATGCCATTCAGTTCGGCGCTGCCCTGGCCATTGCCTCGTGCCCGCTT
GGCCCCAGGGTTAGGGCCTTGGTTGGAAGACACGACCACTCGCAGCCAGCGGAACGCTTTAGTGTGCCTTCGAGCAGAGACTCGGTCAACAAGATCTTGGTTGCCTTCGATAAACACGGC
CTTTCACCCAGGGATGTCGTAGCGCTCCTAGGAATCCACAGCGCTGCTTTTCAGGAGTTCGACATCCCATCCCTAGGAGTCGTCGCACTGGATTCTACGCCCTATATTGACGACATGAGG
TATTACCAGGAGACGATTGCCGGAACTGCACCCCACAGTCTCCAGAGCGACCGTCTTATGACAAAAGCTCCTCAG
GTACGTTCTCCCCCCCTTCATGTTTAGCATTTGTCTCTTTTTTTT
TCTTTTGAGAACCTTACTGACCCCTTTGCAACAGACTAAAGACGCGTTCGCGGAGTTCGCCAGTGACGCCTACGCATGGAATAAAGCGTTTGTTGAAGCTTTTGGCCGCCTGTCTACGAT
CGGTAACGAGCATGTCAAATTCACTGACTGCTCCCATTTGATCCCCAACAGCCCCCCTGTCCCCAGGAAGAGGCAGATCCAGAACTTGAAGTTTACCCAGAAGTTGGCCGAGAAGTTTGG
CGTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGTTTTTCACCAATCCCCCTCCTCGCTGTGCTGGCAGCAACACCCATCTTAGCCGAAGAGCTCGCGCCGCGATATGATGCCTGTCCTCCTGTCTGGAAAGACGTTGTAAATTATCTC
AAGCCCAAATTCAGCGGTTGCTCTAGATCCGCCCACAAAATAATTCGCGCAGCGTTTCATGATTGCATCAACAATGGGTGTGACGGCAGCTTAGCCCTCAGTGATGAGCGCACCCATCCT
GAGAACCAGGGTCTTCAGGAGACTTGCGAACTGGTTGTGGATTTGAAGAAGCGATTCAGCGTCAGTGCGGCCGATGCCATTCAGTTCGGCGCTGCCCTGGCCATTGCCTCGTGCCCGCTT
GGCCCCAGGGTTAGGGCCTTGGTTGGAAGACACGACCACTCGCAGCCAGCGGAACGCTTTAGTGTGCCTTCGAGCAGAGACTCGGTCAACAAGATCTTGGTTGCCTTCGATAAACACGGC
CTTTCACCCAGGGATGTCGTAGCGCTCCTAGGAATCCACAGCGCTGCTTTTCAGGAGTTCGACATCCCATCCCTAGGAGTCGTCGCACTGGATTCTACGCCCTATATTGACGACATGAGG
TATTACCAGGAGACGATTGCCGGAACTGCACCCCACAGTCTCCAGAGCGACCGTCTTATGACAAAAGCTCCTCAG
ACTAAAGACGCGTTCGCGGAGTTCGCCAGTGACGCCTACGCATGG
AATAAAGCGTTTGTTGAAGCTTTTGGCCGCCTGTCTACGATCGGTAACGAGCATGTCAAATTCACTGACTGCTCCCATTTGATCCCCAACAGCCCCCCTGTCCCCAGGAAGAGGCAGATC
CAGAACTTGAAGTTTACCCAGAAGTTGGCCGAGAAGTTTGGCGTCTAA

Retrieve as FASTA