Entry information : PrubGPx01
Entry ID 11738
Creation 2013-04-10 (Christophe Dunand)
Last sequence changes 2013-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: PrubGPx01
Name PrubGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Paxillaceae Paxillus
Organism Paxillus rubicundulus    [TaxId: 463315 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PrubGPx01
start..stop
S start..stop
PinvGPx 398 1.72e-143 1..219 1..222
PadelGPx01 349 6.16e-125 56..221 1..166
GliviGPx01 320 2.23e-113 56..221 1..166
HpinGPx01 320 3.16e-113 56..221 1..166
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11738' 'join(38684..38964,39041..39063,39124..39191,39249..39422,39476..39592)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 38684..38964 279 N° 2 39041..39063 21 N° 3 39124..39191 66 N° 4 39249..39422 172
N° 5 39476..39592 115  
join(38684..38964,39041..39063,39124..39191,39249..39422,39476..39592)


exon

Literature and cross-references PrubGPx01
DNA ref. JGI genome:   scaffold_146 (38684..39592)
Cluster/Prediction ref. JGI gene:   825594 [Incorrect prediction]
Protein sequence: PrubGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   24877.63  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLEMIPRSTRHLSLINKYYSLPSLLASRQPEHSRIFISIHQRFQPFHSTLSTQTMSSTTNFYDLKADLPNGNSYNFDDLKGKVVLIVNVASECGFTPQYGLQALYDKYKERGFLILGFP
CN
FGGQEPGDDATIASFCERNHGVTFPLMKKSDVNGDNTNPVYEWLKNEKAGILGLTRIKWNFEKFLVDQEGKVVNRWASTTTPQTIDTAVEKLLAGTE

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns). Incorrect prediction from JGI (5' end is missing).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTATTGGAAATGATTCCAAGGTCCACTCGTCATCTATCTCTTATAAACAAGTATTATTCCCTACCAAGTCTCCTGGCTTCGCGACAGCCAGAGCACTCACGAATTTTTATTTCAATA
CATCAGCGCTTTCAGCCGTTCCATTCTACCCTATCAACACAAACAATGTCTTCCACCACCAATTTCTACGACCTCAAGGCTGACCTTCCCAATGGAAACAGCTATAACTTCGACGATCTG
AAAGGGAAAGTGGTTCTCATCGTCAACGTTGCATCAGAATG
TGGTGCGTCAAGTGTTTCGACTGGATTTGTGGAACCTCCAAGACAGCCCAAGACTCACTGAACTCCATGGATCTGCAGC
GGATTCACCCCTCAGTACAAAG
AGGTATGCTGCACACGTTGTATACTGGCCCCCTTTTGTTGGGAATTAATCAACAATTTACAGGTCTCCAAGCTCTTTATGACAAATACAAAGAACGCG
GATTCCTGATTCTCGGGTTCCCTTGCAACCAA
AAGTGAGTGAGCCCGCGCGTTACTTCCGAATCCTCGTTTGCTAATATCGCCACATCTAGTTTGGTGGTCAGGAACCTGGTGACGACGC
AACCATCGCATCATTCTGTGAGCGCAATCACGGAGTCACCTTCCCCCTCATGAAGAAATCCGACGTCAATGGAGACAACACTAATCCCGTTTACGAATGGCTCAAGAACGAGAAGGCAGG
GATCTTGGGTTTGACACGGATCAAG
AGGTTCGTGCGCGGCCGCTCCCTGACTTTGTTGAATTTTGATGGGGTCGCTATAGTGGAACTTTGAGAAGTTTTTGGTCGATCAGGAGGGCAAGG
TCGTAAATCGCTGGGCGTCAACTACGACGCCCCAAACGATCGACACTGCTGTTGAGAAGCTGCTTGCTGGAACTGAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTATTGGAAATGATTCCAAGGTCCACTCGTCATCTATCTCTTATAAACAAGTATTATTCCCTACCAAGTCTCCTGGCTTCGCGACAGCCAGAGCACTCACGAATTTTTATTTCAATA
CATCAGCGCTTTCAGCCGTTCCATTCTACCCTATCAACACAAACAATGTCTTCCACCACCAATTTCTACGACCTCAAGGCTGACCTTCCCAATGGAAACAGCTATAACTTCGACGATCTG
AAAGGGAAAGTGGTTCTCATCGTCAACGTTGCATCAGAATG
CGGATTCACCCCTCAGTACAAAGGTCTCCAAGCTCTTTATGACAAATACAAAGAACGCGGATTCCTGATTCTCGGGTTC
CCTTGCAACCAA
TTTGGTGGTCAGGAACCTGGTGACGACGCAACCATCGCATCATTCTGTGAGCGCAATCACGGAGTCACCTTCCCCCTCATGAAGAAATCCGACGTCAATGGAGACAAC
ACTAATCCCGTTTACGAATGGCTCAAGAACGAGAAGGCAGGGATCTTGGGTTTGACACGGATCAAG
TGGAACTTTGAGAAGTTTTTGGTCGATCAGGAGGGCAAGGTCGTAAATCGCTGG
GCGTCAACTACGACGCCCCAAACGATCGACACTGCTGTTGAGAAGCTGCTTGCTGGAACTGAG

Retrieve as FASTA