1. Browse the Database
  2. View Redoxidase
Entry information : PrubGPx01
Entry ID 11738
Creation 2013-04-10 (Christophe Dunand)
Last sequence changes 2013-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: PrubGPx01
Name PrubGPx01
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Paxillaceae Paxillus
Organism Paxillus rubicundulus    [TaxId: 463315 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PrubGPx01
start..stop		 S start..stop
PinvGPx 398 1.73e-143 1..219 1..222
PadelGPx01 349 6.18e-125 56..221 1..166
GliviGPx01 320 2.23e-113 56..221 1..166
HpinGPx01 320 3.17e-113 56..221 1..166
Gene structure Fichier Exons►


exon

Literature and cross-references PrubGPx01
DNA ref. JGI genome:   scaffold_146 (38684..39592)
Cluster/Prediction ref. JGI gene:   825594 [Incorrect prediction]
Protein sequence: PrubGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221
PWM (Da):   %s   24877.63  
PI (pH):   %s   8.44
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLLEMIPRSTRHLSLINKYYSLPSLLASRQPEHSRIFISIHQRFQPFHSTLSTQTMSSTTNFYDLKADLPNGNSYNFDDLKGKVVLIVNVASECGFTPQYGLQALYDKYKERGFLILGFP
CNFGGQEPGDDATIASFCERNHGVTFPLMKKSDVNGDNTNPVYEWLKNEKAGILGLTRIKWNFEKFLVDQEGKVVNRWASTTTPQTIDTAVEKLLAGTE

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns). Incorrect prediction from JGI (5' end is missing).
DNA ►
Send to BLAST
CDS►
Send to BLAST