Entry information : HC14APx-CcP04
Entry ID 11760
Creation 2013-04-17 (Christophe Dunand)
Last sequence changes 2013-04-17 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-25 (Catherine Mathe (Scipio))
Peroxidase information: HC14APx-CcP04
Name HC14APx-CcP04
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Fungi/Metazoa; Fungi; Ascomycota; Ascomycota
Organism Hypoxylon sp. C14A    [TaxId: 755336 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HC14APx-CcP04
start..stop
S start..stop
HCO27APx-CcP03 1338 0 1..828 1..826
HCO27APx-CcP03 131 1.26e-31 710..830 598..720
HEC38APx-CcP03 1316 0 1..828 1..808
HEC38APx-CcP03 122 9.54e-29 714..830 584..702
XhypAPx-CcP01 1057 0 1..813 1..794
XhypAPx-CcP01 172 1.24e-44 592..811 686..906
XhypAPx-CcP01 170 7.8e-44 613..811 820..1010
DescAPx-CcP02 911 0 17..544 6..533
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '11760' 'join(388995..390140,390205..390393,390449..391100,391154..391659)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 388995..390140 1144 N° 2 390205..390393 187 N° 3 390449..391100 650 N° 4 391154..391659 504
join(388995..390140,390205..390393,390449..391100,391154..391659)


exon

Literature and cross-references HC14APx-CcP04
DNA ref. JGI genome:   scaffold_18 (388995..391659)
Protein sequence: HC14APx-CcP04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   830 (810)
PWM (Da):   %s   87578.47 (85162.1)  
PI (pH):   %s   4.25 (4.20) Peptide Signal:   %s   cut: 21 range:21-830
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFWRIAYWGVLISLGGLIRAADPTWPSPNDELEEIMYQVEGYRSRNFGGTVIPCSSEASGPGRQNAAEWLRAAFHDMSTTTNLGGVRAGGMDGSLQYELTSSDNLGPGFNTTLKFMADYY
TSRSSVADLIALGVYYAVRSCGGPVVPVSGGRIDAVAGGPIGVPLPQNTAFTFEQQFIRMGFDKIEMIQVTACGHSIGGVHENEFPEIVPVGSTTNGEVPLDSTVAAFDNKVITEYIAGN
TTNPMVVGPSIKATRNADFKVFNYDGNVTVNAMAGATEFNSVCATVLQKLIDTVPNGVVLSDPIQPYSVKPVDMQLALNSGGSTMQLTGFIRVRTTDLGGDSVSSLTLKYKDRNGGTDCG
NTDCTYEATVLGASRGFDDEFSWFPINAAISTTTGISSFVLTLNMASGTAQILDNNGESYPMQDGILIQQPQSCLFSGTLTVTAAVRNDRKSLPVNMFLSYKTPTGNPNRPVPTLKNATV
VMIEETCVGSYTFYTANYTDLGDLAYASKIDIVSGSGSSALKDDFNAASNLGGTCRPFQNPPSSCTTGQGSTAPGTTTTSSVSSTSTSSTVSTTSSITSTSLSTTSSTTLSSTSTSPTAP
AETLHHRQDLGEYTLVGCQKESTVSGTRALGDASFAYDSMTLESCMKNCTGYVFWGTEYGRECYCGNSLQATSEDAPLTDCNMVCGGDSTEYCGDSNRIELYSTTASQPAPTATLAPKPT
VSSYVRVGCYTEVQGGRALTGASYADDAMTLEKCASDCVGFSYWATEYGRECYCGNILDSLSTSVSDADCNMVCAGDGYEYCGSGNRLELYQLATASSESSARITPSPSL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Peroxidase domain fused to 2 WSC domains (putative carbohydrate binding domain)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTTGGCGTATCGCATATTGGGGCGTCCTGATATCCCTCGGGGGCCTCATCAGGGCTGCTGATCCAACATGGCCATCCCCAAATGACGAACTCGAAGAGATAATGTACCAAGTCGAA
GGGTACAGATCTCGAAACTTTGGTGGAACTGTCATTCCATGCTCCAGTGAAGCATCTGGACCTGGCCGACAGAATGCCGCAGAATGGTTGCGGGCAGCTTTTCACGATATGTCCACGACA
ACAAATTTAGGTGGTGTACGAGCTGGTGGAATGGATGGCTCTCTGCAGTACGAGTTGACGAGCTCAGACAACCTTGGGCCAGGCTTCAACACAACTCTCAAGTTCATGGCAGATTATTAC
ACAAGTCGGTCAAGTGTGGCGGATCTCATCGCCCTAGGTGTCTATTATGCCGTGAGATCGTGTGGTGGTCCTGTGGTTCCCGTTTCTGGTGGCAGAATCGACGCAGTAGCAGGTGGCCCT
ATTGGTGTGCCTCTCCCGCAGAATACCGCCTTCACCTTTGAGCAGCAGTTCATACGGATGGGATTCGACAAGATAGAAATGATTCAGGTCACTGCTTGTGGTCATTCCATTGGAGGCGTT
CACGAAAACGAGTTTCCCGAGATCGTTCCAGTAGGATCTACTACTAACGGTGAAGTTCCATTGGACTCGACAGTTGCTGCATTCGACAACAAGGTAATTACAGAATACATTGCCGGCAAT
ACGACTAACCCAATGGTGGTTGGGCCATCGATCAAGGCTACGAGGAATGCAGACTTCAAGGTCTTCAATTATGATGGCAATGTGACGGTTAACGCCATGGCGGGAGCCACCGAGTTCAAC
AGCGTATGCGCGACCGTTCTTCAAAAGCTGATTGATACGGTTCCCAATGGCGTGGTTTTGTCAGATCCCATCCAGCCTTATTCAGTTAAACCAGTTGATATGCAGTTGGCACTCAACTCC
GGGGGCTCTACAATGCAGTTGACTGGATTTATACGTGTACGAACCACTGATCTGGGAGGAGATTCTGTCTCAAGCCTGACGTTGAAGTATAAAGATCGGAATGGGGGAACTGACTGTGGT
AATACGGACTGCACATATGAAGCTACAGTTTTAGGTGCAAGCCGAGGCTTCGATGATGAATTTTCC
CCGTGAGTGTGAACCCCTATTATCTTTAACTATATTCCAGTGTGGATCTAACGC
ATACCGTACTAGTGGTTTCCTATCAATGCTGCCATCTCAACTACTACAGGCATATCGTCTTTTGTGTTAACCCTCAATATGGCCAGCGGGACGGCTCAAATATTGGATAACAATGGGGAG
TCGTACCCTATGCAAGATGGAATCTTGATTCAACAACCCCAGAGCTGTCTGTTTTCTGGCACCCTCACTGTGACAGCCGCC
CCGTTGGTTACTCTTGACATTATTATATGTGGAAAAATG
CTAACGCGGTTTACCCAGGTACGAAACGACCGAAAGTCCCTTCCTGTTAACATGTTTCTCTCGTACAAGACACCAACAGGAAATCCCAATCGTCCTGTACCGACCTTGAAGAATGCCACC
GTTGTTATGATTGAAGAAACTTGCGTAGGCTCATATACATTTTACACGGCCAATTACACTGACCTCGGCGATCTTGCGTACGCGTCCAAGATCGATATTGTGAGCGGTAGCGGTTCTTCG
GCTCTGAAGGACGATTTCAACGCAGCCAGCAACTTGGGAGGAACATGTCGACCTTTCCAGAATCCACCATCATCATGTACAACCGGACAAGGATCGACCGCACCTGGGACAACGACCACC
TCGTCTGTAAGCAGCACATCCACCTCATCAACTGTTAGCACTACCTCGTCGATTACCTCAACTTCGCTGTCTACCACTTCGTCTACTACGCTAAGTAGCACGAGTACTTCCCCCACAGCA
CCAGCTGAGACTTTGCACCACAGGCAAGACCTCGGTGAGTATACGCTCGTAGGTTGCCAAAAAGAGTCAACAGTGTCAGGAACTCGAGCTTTGGGCGACGCCTCATTCGCATATGATAGT
ATGACGTTAGAGAGCTGTATGAAGAACTGTACCGGATATGTGTTTTGGGGCACAGAGTATGGCCGAGAGT
GTGTAAGGATTTTCGGTTGAACCCTCCAAAGCTATAAAGCTGACAATTTG
AGTAGGTTATTGCGGTAATTCACTTCAAGCAACGAGCGAAGATGCGCCCCTGACTGACTGCAATATGGTCTGCGGCGGAGACTCTACCGAATACTGTGGAGACAGCAACAGGATAGAATT
GTACAGCACCACAGCCAGTCAACCGGCCCCTACTGCCACATTAGCCCCCAAGCCAACAGTATCGTCATACGTCCGAGTTGGCTGCTACACCGAGGTCCAGGGTGGCCGAGCGTTGACCGG
TGCAAGCTACGCCGACGACGCTATGACGTTGGAAAAGTGTGCTTCGGATTGTGTTGGCTTTAGTTATTGGGCTACCGAGTACGGCCGTGAATGCTACTGCGGAAATATCTTGGATAGTCT
CAGCACGTCTGTTTCTGATGCCGACTGTAACATGGTCTGCGCTGGTGATGGCTATGAGTATTGTGGCTCCGGAAACCGACTTGAGTTGTATCAATTAGCAACGGCATCCTCAGAGTCTTC
AGCGAGGATTACCCCAAGCCCAAGCTTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTTGGCGTATCGCATATTGGGGCGTCCTGATATCCCTCGGGGGCCTCATCAGGGCTGCTGATCCAACATGGCCATCCCCAAATGACGAACTCGAAGAGATAATGTACCAAGTCGAA
GGGTACAGATCTCGAAACTTTGGTGGAACTGTCATTCCATGCTCCAGTGAAGCATCTGGACCTGGCCGACAGAATGCCGCAGAATGGTTGCGGGCAGCTTTTCACGATATGTCCACGACA
ACAAATTTAGGTGGTGTACGAGCTGGTGGAATGGATGGCTCTCTGCAGTACGAGTTGACGAGCTCAGACAACCTTGGGCCAGGCTTCAACACAACTCTCAAGTTCATGGCAGATTATTAC
ACAAGTCGGTCAAGTGTGGCGGATCTCATCGCCCTAGGTGTCTATTATGCCGTGAGATCGTGTGGTGGTCCTGTGGTTCCCGTTTCTGGTGGCAGAATCGACGCAGTAGCAGGTGGCCCT
ATTGGTGTGCCTCTCCCGCAGAATACCGCCTTCACCTTTGAGCAGCAGTTCATACGGATGGGATTCGACAAGATAGAAATGATTCAGGTCACTGCTTGTGGTCATTCCATTGGAGGCGTT
CACGAAAACGAGTTTCCCGAGATCGTTCCAGTAGGATCTACTACTAACGGTGAAGTTCCATTGGACTCGACAGTTGCTGCATTCGACAACAAGGTAATTACAGAATACATTGCCGGCAAT
ACGACTAACCCAATGGTGGTTGGGCCATCGATCAAGGCTACGAGGAATGCAGACTTCAAGGTCTTCAATTATGATGGCAATGTGACGGTTAACGCCATGGCGGGAGCCACCGAGTTCAAC
AGCGTATGCGCGACCGTTCTTCAAAAGCTGATTGATACGGTTCCCAATGGCGTGGTTTTGTCAGATCCCATCCAGCCTTATTCAGTTAAACCAGTTGATATGCAGTTGGCACTCAACTCC
GGGGGCTCTACAATGCAGTTGACTGGATTTATACGTGTACGAACCACTGATCTGGGAGGAGATTCTGTCTCAAGCCTGACGTTGAAGTATAAAGATCGGAATGGGGGAACTGACTGTGGT
AATACGGACTGCACATATGAAGCTACAGTTTTAGGTGCAAGCCGAGGCTTCGATGATGAATTTTCC
TGGTTTCCTATCAATGCTGCCATCTCAACTACTACAGGCATATCGTCTTTTGTG
TTAACCCTCAATATGGCCAGCGGGACGGCTCAAATATTGGATAACAATGGGGAGTCGTACCCTATGCAAGATGGAATCTTGATTCAACAACCCCAGAGCTGTCTGTTTTCTGGCACCCTC
ACTGTGACAGCCGCC
GTACGAAACGACCGAAAGTCCCTTCCTGTTAACATGTTTCTCTCGTACAAGACACCAACAGGAAATCCCAATCGTCCTGTACCGACCTTGAAGAATGCCACCGTT
GTTATGATTGAAGAAACTTGCGTAGGCTCATATACATTTTACACGGCCAATTACACTGACCTCGGCGATCTTGCGTACGCGTCCAAGATCGATATTGTGAGCGGTAGCGGTTCTTCGGCT
CTGAAGGACGATTTCAACGCAGCCAGCAACTTGGGAGGAACATGTCGACCTTTCCAGAATCCACCATCATCATGTACAACCGGACAAGGATCGACCGCACCTGGGACAACGACCACCTCG
TCTGTAAGCAGCACATCCACCTCATCAACTGTTAGCACTACCTCGTCGATTACCTCAACTTCGCTGTCTACCACTTCGTCTACTACGCTAAGTAGCACGAGTACTTCCCCCACAGCACCA
GCTGAGACTTTGCACCACAGGCAAGACCTCGGTGAGTATACGCTCGTAGGTTGCCAAAAAGAGTCAACAGTGTCAGGAACTCGAGCTTTGGGCGACGCCTCATTCGCATATGATAGTATG
ACGTTAGAGAGCTGTATGAAGAACTGTACCGGATATGTGTTTTGGGGCACAGAGTATGGCCGAGAGT
GTTATTGCGGTAATTCACTTCAAGCAACGAGCGAAGATGCGCCCCTGACTGAC
TGCAATATGGTCTGCGGCGGAGACTCTACCGAATACTGTGGAGACAGCAACAGGATAGAATTGTACAGCACCACAGCCAGTCAACCGGCCCCTACTGCCACATTAGCCCCCAAGCCAACA
GTATCGTCATACGTCCGAGTTGGCTGCTACACCGAGGTCCAGGGTGGCCGAGCGTTGACCGGTGCAAGCTACGCCGACGACGCTATGACGTTGGAAAAGTGTGCTTCGGATTGTGTTGGC
TTTAGTTATTGGGCTACCGAGTACGGCCGTGAATGCTACTGCGGAAATATCTTGGATAGTCTCAGCACGTCTGTTTCTGATGCCGACTGTAACATGGTCTGCGCTGGTGATGGCTATGAG
TATTGTGGCTCCGGAAACCGACTTGAGTTGTATCAATTAGCAACGGCATCCTCAGAGTCTTCAGCGAGGATTACCCCAAGCCCAAGCTTGTAG

Retrieve as FASTA