Entry information : SpuGPx02
Entry ID 11788
Creation 2013-04-24 (Christophe Dunand)
Last sequence changes 2013-04-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-04-24 (Christophe Dunand)
Peroxidase information: SpuGPx02
Name SpuGPx02
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Chytridiomycota Chytridiomycetes Spizellomycetaceae Spizellomyces
Organism Spizellomyces punctatus    [TaxId: 109760 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SpuGPx02
start..stop
S start..stop
SpuGPx01 278 3e-97 1..162 50..212
CglGPx01 234 1e-80 6..162 5..161
VpolGPx01 231 4e-79 4..162 1..159
AoliGPx01 230 8e-79 7..154 9..156
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 221535..221753 219 N° 2 221821..222090 270  
join(221535..221753,221821..222090)


exon

Literature and cross-references SpuGPx02
Cluster/Prediction ref. Broad:   S7000007187931154
Protein sequence: SpuGPx02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   163
PWM (Da):   %s   18000.34  
PI (pH):   %s   8.04
Sequence 204
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTVIGSFHELQVNDKRGKPFDLSQLKGKVVIVVNVASKCGFTPQYKGLEELYQQYKDQGLVILGFPCNQFGSQAPGSAEEEGAVCQLNYGVTFPIMEKVEVNGDNVHPVYEWLKEQKAGLLGLRRIKWNFEKFLIDKDGKVVARYASTTEPASVGKDAVKLL*

Retrieve as FASTA  
Remarks complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACTGTTATCGGATCCTTCCACGAACTGCAAGTCAACGACAAGCGCGGCAAGCCTTTCGATCTGTCCCAACTCAAGGGGAAGGTTGTCATTGTTGTAAACGTTGCCTCCAAGTGTGGTT
TCACGCCCCAGTACAAGGGTCTTGAAGAGTTGTACCAACAATACAAGGACCAGGGTCTTGTCATCCTCGGCTTCCCATGCAACCAGTTTGGTAGCCAG
GTACGTTGCCAATTGAGCATCA
TCATTCCAGACTGGATATTGACATGATGTTTGCACATTTCATTAGGCTCCAGGCTCCGCTGAAGAGGAAGGCGCCGTCTGCCAACTCAACTATGGTGTGACTTTCCCCATTATGGAGAAG
GTGGAAGTGAACGGAGACAACGTTCACCCAGTTTACGAATGGCTCAAGGAACAAAAGGCTGGATTGTTGGGGCTAAGGAGGATCAAGTGGAACTTTGAGAAATTCTTGATTGACAAGGAC
GGAAAGGTTGTTGCTCGTTATGCCAGTACAACTGAACCTGCCTCAGTCGGCAAGGACGCTGTCAAGCTTTTGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACTGTTATCGGATCCTTCCACGAACTGCAAGTCAACGACAAGCGCGGCAAGCCTTTCGATCTGTCCCAACTCAAGGGGAAGGTTGTCATTGTTGTAAACGTTGCCTCCAAGTGTGGTT
TCACGCCCCAGTACAAGGGTCTTGAAGAGTTGTACCAACAATACAAGGACCAGGGTCTTGTCATCCTCGGCTTCCCATGCAACCAGTTTGGTAGCCAG
GCTCCAGGCTCCGCTGAAGAGG
AAGGCGCCGTCTGCCAACTCAACTATGGTGTGACTTTCCCCATTATGGAGAAGGTGGAAGTGAACGGAGACAACGTTCACCCAGTTTACGAATGGCTCAAGGAACAAAAGGCTGGATTGT
TGGGGCTAAGGAGGATCAAGTGGAACTTTGAGAAATTCTTGATTGACAAGGACGGAAAGGTTGTTGCTCGTTATGCCAGTACAACTGAACCTGCCTCAGTCGGCAAGGACGCTGTCAAGC
TTTTGTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCGGGCAAT GATCGCATAC CGGCTCCGCT TGCAGCTTCA GATATAAAAA GCCCTTCACG TCGAATGCAA TCGCCCAACA ATACTCTACA CATTCTTTCG ATCAAAGCAA GCACACCCAT  AACACCGCAA ACATGACTGT TATCGGATCC TTCCACGAAC TGCAAGTCAA CGACAAGCGC GGCAAGCCTT TCGATCTGTC CCAACTCAAG GGGAAGGTTG TCATTGTTGT AAACGTTGCC  TCCAAGTGTG GTTTCACGCC CCAGTACAAG GGTCTTGAAG AGTTGTACCA ACAATACAAG GACCAGGGTC TTGTCATCCT CGGCTTCCCA TGCAACCAGT TTGGTAGCCA GGCTCCAGGC  TCCGCTGAAG AGGAAGGCGC CGTCTGCCAA CTCAACTATG GTGTGACTTT CCCCATTATG GAGAAGGTGG AAGTGAACGG AGACAACGTT CACCCAGTTT ACGAATGGCT CAAGGAACAA  AAGGCTGGAT TGTTGGGGCT AAGGAGGATC AAGTGGAACT TTGAGAAATT CTTGATTGAC AAGGACGGAA AGGTTGTTGC TCGTTATGCC AGTACAACTG AACCTGCCTC AGTCGGCAAG  GACGCTGTCA AGCTTTTGTA GTGTAGTGTG TAGTGTGTAT AGGACAGATT TATAGAGGAG GGTTTGGGAG TACATTTGGG AGGAACCAGC TTATTGTTTA TATCATTGGA TTATTTTGCA 
TTTGAATATT ATACCGTGCA CACTTGGGCA CATAATCGTA 

Retrieve as FASTA